secretin receptor family (class B GPCR) · human

GLP-1R

GLP-1 receptor
glucagon-like peptide-1 receptor · UniProt P43220 · gene GLP1R
weight loss diabetes gut

GLP-1R is the hottest target in peptide therapeutics. Semaglutide (Ozempic/Wegovy), liraglutide (Victoza/Saxenda), dulaglutide (Trulicity), and tirzepatide (Mounjaro) are multi-billion-dollar drugs acting on this receptor.

Next-gen candidates include retatrutide (triple agonist: GLP-1R/GIPR/GCGR), CagriSema (semaglutide + cagrilintide combo, PDUFA ~Oct 2026), and oral formulations. The key challenge: muscle loss under GLP-1 therapy drives interest in myostatin inhibition as a combination strategy.

browse 228 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Semaglutide: Ozempic/Wegovy weight-loss & diabetes drug

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG · 31 aa · @peptidemodel

bioassayed pep-00016 @peptidemodel refs: 6

all cards · 228 candidates against GLP-1R

# id title author status refs ipSAE_d0chn
4 pep-10891 Lixisenatide: Adlyxin/Lyxumia type 2 diabetes drug pe@peptidemodel
21 0
5 pep-10577 GLP-1 (1-37): unprocessed precursor of the gut hormone behind Ozempic pe@peptidemodel
11 0
6 pep-10600 Oxyntomodulin: natural gut hormone behind dual weight-loss drugs pe@peptidemodel
10 0
7 pep-10503 Bone-building peptide from a cancer-linked protein (PTHrP 1-36) pe@peptidemodel
10 0
8 pep-10575 GLP-1: the natural gut hormone behind Ozempic-class drugs pe@peptidemodel
9 0
9 pep-10525 GLP-1 receptor blocker for research (Exendin 9-39) pe@peptidemodel
9 0
10 pep-00018 Retatrutide: LY3437943, triple-action weight-loss drug (GIP/GLP-1/glucagon) pe@peptidemodel
5 1
11 pep-10569 GLP-2: natural gut-lining growth hormone (Glucagon-like peptide-2) pe@peptidemodel
8 0
12 pep-04453 Insulin B chain: half of the blood-sugar hormone insulin pe@peptidemodel
3 0
13 pep-04476 Urocortin: natural stress & heart-protection hormone (UCN1) pe@peptidemodel
3 0
14 pep-10488 β-CGRP: natural nerve-signaling peptide of the calcitonin family pe@peptidemodel
5 0
15 pep-10620 Neuromedin S: brain clock and appetite-suppressing neuropeptide pe@peptidemodel
4 0
16 pep-10608 Amylin: hunger-suppressing pancreas hormone (hamster research form) pe@peptidemodel
4 0
17 pep-10532 GLP-1 receptor blocker (Exendin-4 (3-39)) pe@peptidemodel
4 0
18 pep-04450 GLP-1: the gut hormone that inspired Ozempic and Wegovy (natural form) pe@peptidemodel
1 0
19 pep-10609 Amylin (mouse/rat): safer rodent form of the meal-time blood-sugar hormone pe@peptidemodel
2 0
20 pep-10549 Urocortin III: stress-recovery & heart-protective hormone pe@peptidemodel
2 0
1–20 of 228

target literature · 222 curated papers

[1]
Madsbad, Sten et al. 2025 Expert Opinion on Investigational Drugs The promise of glucagon-like peptide 1 receptor agonists (GLP-1RA) for the treatment of obesity: a look at phase 2 and 3 pipelines
cited by
3
cards
[2]
Gasbjerg, Lærke S. et al. 2026 Physiological Reviews Proglucagon-derived peptides: human physiology and therapeutic potential
cited by
4
cards
[4]
Parker, Victoria E. R. et al. 2023 Nature Metabolism Cotadutide promotes glycogenolysis in people with overweight or obesity diagnosed with type 2 diabetes
cited by
1
cards
[6]
Lafferty, Ryan A. et al. 2021 Frontiers in Endocrinology Proglucagon-Derived Peptides as Therapeutics
cited by
15
cards
[7]
Meissner, W. et al. 2024 New England Journal of Medicine Trial of Lixisenatide in Early Parkinson’s Disease
cited by
1
cards
[8]
Pfeffer, M. et al. 2015 New England Journal of Medicine Lixisenatide in Patients with Type 2 Diabetes and Acute Coronary Syndrome
cited by
1
cards
recent news 5 articles

discussion · 0 threads

No discussion threads yet.