pe
pep-00016 v1 CC-BY-SA-4.0

Semaglutide: Ozempic/Wegovy weight-loss & diabetes drug

A prescription drug that mimics a natural fullness hormone, telling the brain you're full; lowers blood sugar and causes significant weight loss. FDA-approved.

statusbioassayed targetGLP-1R length31 aa mass4113.58 Da refs6
fda-approvedglp-1-agonistweight-lossdiabetesincretinweekly
snapshot approved 95% confidence
Class
GLP-1 receptor agonist
Status
FDA-approved prescription drug (Ozempic 2017, Rybelsus 2019, Wegovy 2021, Wegovy MASH 2025, Oral Wegovy late 2025); also authorized in EU, UK, Canada, and Australia
Best-supported effect
~15% mean body-weight reduction at 2.4 mg weekly over 68 weeks (STEP-1); HbA1c reduction in type 2 diabetes (SUSTAIN); 20% relative MACE reduction in adults with overweight/obesity and established CV disease (SELECT)
Main caveat
Benefits are tied to ongoing therapy — STEP-4 and STEP-1 extension data show roughly two-thirds of lost weight is regained within a year of discontinuation. GI adverse events are common, and the EVOKE / EVOKE+ Phase 3 readout in early Alzheimer's disease was negative.
status 2 / 5 · 0 verified on platform
prediction metrics boltz-2 1.0
ipTM0.924
pTM0.830
avg pLDDT75.8
ranking score0.791
STRUCTURE · PEP-00016 × GLP-1R
ranking0.791
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence31 aa
15101520253031
HAEGTFTSDVSSYLEG QAAKEFIAWLVRGRG
in the news 141 articles
overview readme

What this is

Semaglutide is a prescription medication that mimics GLP-1, a natural gut hormone that signals fullness after eating. Sold under the names Ozempic and Rybelsus (type 2 diabetes) and Wegovy (weight management), it is FDA-approved and one of the most widely prescribed peptide drugs in medicine. It is a 31-residue modified GLP-1 analog developed by Novo Nordisk; two chemical changes extend the half-life from minutes (native GLP-1) to roughly one week — an aminoisobutyric acid substitution at position 2 that blocks enzymatic cleavage, and a C-18 fatty diacid side chain at position 26 that enables reversible albumin binding. The raw stored sequence (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG) represents the bare amino acid backbone; neither the fatty diacid chain nor the modified residue at position 2 appears in this one-letter rendering.

History

Semaglutide was developed by Novo Nordisk as a structural successor to liraglutide, designed to extend GLP-1 receptor agonism from once-daily to once-weekly dosing. The FDA approved Ozempic for type 2 diabetes in December 2017 following the SUSTAIN trial program. Rybelsus — the first oral GLP-1 agonist — received approval in September 2019, enabled by co-formulation with the absorption enhancer SNAC. Wegovy, at the higher 2.4 mg dose for chronic weight management, followed in June 2021. In March 2024 Wegovy's label was extended to include reduction of major adverse cardiovascular events in adults with overweight or obesity and established cardiovascular disease, based on the SELECT trial. In August 2025 the FDA granted accelerated approval for a MASH (non-cirrhotic, stage 2–3 fibrosis) indication, and an oral 25 mg Wegovy tablet was approved in late 2025.

What it does

In simple terms, semaglutide tells the brain you are full, slows the rate at which food leaves the stomach, and prompts the pancreas to release insulin when blood sugar rises — but only when blood sugar is actually elevated, which limits the risk of hypoglycemia on its own. The practical result is reduced appetite, lower food intake, weight loss, and improved blood sugar control. Large Phase 3 trials also demonstrated cardiovascular and kidney-protective effects that extend beyond what weight loss alone explains (Wilding et al., NEJM 2021; McGuire et al., NEJM 2025).

Evidence

  • Human: Extensive Phase 3 trial evidence across multiple programs. The STEP program (obesity; STEP-1 published Wilding et al., NEJM 2021) showed a mean 14.9% body-weight reduction at 68 weeks versus 2.4% on placebo in adults with overweight or obesity. STEP-4 (Rubino et al., JAMA 2021) demonstrated weight-loss maintenance with continuation and roughly two-thirds regain within a year of stopping. SUSTAIN-6 (Marso et al., NEJM 2016) showed a 26% relative reduction in major adverse cardiovascular events in high-risk type 2 diabetes. SELECT (Lincoff et al., NEJM 2023) extended this to a 20% relative MACE reduction in 17,604 adults with overweight or obesity but without diabetes. FLOW (Perkovic et al., NEJM 2024) reported a 24% relative reduction in kidney disease progression in type 2 diabetes with CKD. ESSENCE part 1 (Sanyal et al., NEJM 2025) showed 63% MASH resolution versus 34% on placebo, forming the basis for the 2025 MASH indication. STEP-HFpEF showed improvement in heart failure symptoms and body weight in heart failure with preserved ejection fraction. EVOKE and EVOKE+ (Phase 3, oral semaglutide 14 mg versus placebo, n=3,808, adults aged 55–85 with mild cognitive impairment or mild Alzheimer's disease) reported no slowing of CDR-SB progression at their topline readout in November 2025 — the first major negative Phase 3 result for semaglutide. The SOUL trial (oral semaglutide in high-risk type 2 diabetes, McGuire et al., NEJM 2025) demonstrated cardiovascular benefit; secondary analyses extended evidence to heart failure outcomes and durable multi-factor CV risk reduction over approximately four years. One randomized trial in adults with alcohol use disorder showed an exploratory signal for reduced alcohol consumption (not a Phase 3 efficacy program).
  • Animal: Comprehensive; GLP-1 biology is among the most studied metabolic pathways. Rodent studies identified a thyroid C-cell carcinogenicity signal that underlies the drug's boxed warning; no equivalent human signal has been detected in the trialed windows.
  • In vitro / mechanistic: GLP-1 receptor pharmacology and downstream cAMP/PKA/Epac2 signaling in pancreatic beta cells are well-characterized.

Known effects

  • Weight loss (~15% mean body weight at 2.4 mg weekly over 68 weeks) — FDA-approved (Wegovy; STEP trials)
  • Blood sugar control in type 2 diabetes — FDA-approved (Ozempic, Rybelsus; SUSTAIN, PIONEER trials)
  • Reduction of major adverse cardiovascular events — FDA-approved (SELECT, SUSTAIN-6); both in T2D populations and in adults with obesity without diabetes
  • Kidney disease progression slowing in T2D + CKD — Phase 3 (FLOW)
  • MASH resolution (non-cirrhotic, stage 2–3 fibrosis) — FDA accelerated approval (ESSENCE, August 2025)
  • Heart failure symptom improvement (HFpEF) — Phase 3 (STEP-HFpEF)
  • Walking capacity improvement in T2D + peripheral artery disease — Phase 3 (STRIDE)
  • Reduction of Parkinson's disease risk (class-level, GLP-1 agonists) — Observational; a meta-analysis of 82 studies reports a roughly 30% lower risk association for GLP-1 receptor agonists as a class; this is not a semaglutide-specific causal finding
  • Alzheimer's disease modification — Contradicted at Phase 3 level; EVOKE / EVOKE+ were negative

Safety signals

Nausea is the most common adverse event — reported in approximately 40–44% of participants across Phase 3 trials, typically transient and attenuating within the first several weeks. Vomiting (~24%), diarrhea (~30%), constipation (~24%), and abdominal pain (~20%) were also common in trials. Aggregate gastrointestinal adverse events in STEP-1 affected 74.2% of the semaglutide group versus 47.9% on placebo (Wilding et al., NEJM 2021).

Acute pancreatitis is rare (less than 1%) but documented; risk is elevated in those with a prior history. Gallbladder events (cholecystitis) occurred in approximately 1.6% of trial participants, with higher incidence at higher doses and during periods of rapid weight loss. Acute kidney injury has been reported rarely, typically associated with dehydration secondary to GI adverse events. Hypoglycemia risk rises substantially when semaglutide is combined with insulin or insulin secretagogues; labeling addresses downward titration of the concomitant agent.

Body-composition sub-studies consistently show that approximately 25–40% of lost weight comes from lean tissue; this is broadly comparable to other methods of equivalent weight loss.

Post-marketing surveillance has tracked severe gastroparesis (rare; subject of multidistrict litigation since 2023), early signals of suicidal ideation (not confirmed in large pharmacovigilance analyses), and diabetic retinopathy progression. Delayed gastric emptying alters the absorption of orally co-administered narrow-therapeutic-index drugs including warfarin and levothyroxine.

Label contraindications / safety exclusions:

  • Personal or family history of medullary thyroid carcinoma (MTC) or Multiple Endocrine Neoplasia syndrome type 2 (MEN2) — boxed warning; based on rodent C-cell tumor findings; human causal link not established in trialed windows
  • Prior serious hypersensitivity reaction to semaglutide
  • Active pancreatitis or history of recurrent pancreatitis
  • Pregnancy (animal reproductive toxicity data; labeling describes discontinuation at least 2 months before a planned pregnancy)
  • Breastfeeding (transfer into human milk not adequately characterized)
  • Severe gastroparesis or significant GI motility disorders
  • Pediatric use below approved age cutoffs (Wegovy approved for adolescents ≥12; Ozempic and Rybelsus not approved under 18)

Regulatory status

  • US (FDA): Approved prescription drug. Ozempic (December 2017, type 2 diabetes); Rybelsus (September 2019, oral type 2 diabetes); Wegovy (June 2021, chronic weight management in adults and adolescents ≥12); Wegovy label expanded March 2024 for MACE reduction in adults with established cardiovascular disease and overweight or obesity; Wegovy accelerated approval August 2025 for non-cirrhotic MASH with stage 2–3 fibrosis; oral Wegovy 25 mg approved late 2025. No FDA-approved generic semaglutide products as of early 2026.
  • EU (EMA): Ozempic, Rybelsus, and Wegovy authorized for parallel indications.
  • UK (MHRA): Approved; NHS coverage of Wegovy is subject to NICE criteria.
  • Canada (Health Canada): Authorized for parallel indications.
  • Australia (TGA): Authorized for parallel indications.
  • WADA: Not currently listed by name on the WADA Prohibited List; increasing scrutiny of GLP-1 agonists in weight-category sports is described in the literature.
  • US compounding: Following removal of the FDA shortage designation in February 2025, traditional 503A pharmacy compounding of semaglutide is no longer permitted outside narrowly defined clinical circumstances. Some compounded products have used semaglutide salts (sodium, acetate) that are structurally distinct from the base peptide in the approved drugs.

Mechanism

Semaglutide is an agonist at the GLP-1 receptor, a Class B G-protein-coupled receptor expressed on pancreatic beta cells, in hypothalamic nuclei (notably the arcuate nucleus), and in the brainstem area postrema.

In pancreatic beta cells, receptor activation raises intracellular cAMP, which drives PKA/Epac2 signaling and enhances glucose-dependent insulin secretion — meaning insulin release is amplified only when blood glucose is elevated, limiting intrinsic hypoglycemia risk. The drug also suppresses glucagon secretion from pancreatic alpha cells and slows gastric emptying, prolonging post-meal satiety.

Centrally, GLP-1 receptor activation in hypothalamic and brainstem appetite-control centers reduces hunger and reward-driven eating. Brain-imaging data cited in the literature are consistent with reduced neural responses to food cues, corresponding to what users describe as quieting of "food noise."

The C-18 fatty diacid side chain at lysine 26 — linked through a γ-glutamic acid spacer that is not represented in the stored sequence — mediates non-covalent reversible albumin binding, extending half-life from minutes (native GLP-1) to approximately one week and enabling once-weekly subcutaneous dosing. The aminoisobutyric acid substitution at position 2 protects the peptide from DPP-4 cleavage.

Direct cardiovascular and renal protective effects beyond weight and glycemic improvement are described in the literature, including slower eGFR decline, reduced proteinuria, and anti-inflammatory signals in the cardiovascular system.

Open questions

  • Long-term outcomes: Cardiovascular, renal, oncologic, and metabolic data beyond the approximately 5-year SELECT and SOUL windows are not yet available.
  • Continuation and cycling: Optimal strategies for indefinite chronic therapy — whether dose holidays preserve efficacy without triggering weight regain — are not resolved in trial data.
  • Body composition: The optimal combination of resistance training, protein intake, and adjunctive pharmacology to mitigate lean-mass loss during rapid weight loss is not rigorously defined.
  • Underrepresented populations: Older adults with frailty, patients with advanced CKD, and pediatric populations below current age cutoffs are underrepresented in pivotal trials.
  • Neuropsychiatric signals: Post-marketing concerns about suicidal ideation are unconfirmed but warrant ongoing surveillance.
  • Neurodegeneration: With EVOKE / EVOKE+ negative for early symptomatic Alzheimer's, the mechanism and clinical relevance of GLP-1 agonism in neurodegeneration — including the class-level Parkinson's-risk observational signal — remain unresolved.
  • Addiction medicine: Whether the alcohol-use-disorder signal from one RCT extends to a regulatory-grade indication is unanswered.

Related peptides

  • Liraglutide — the predecessor once-daily GLP-1 agonist that semaglutide was engineered to replace; same GLP-1 receptor target, shorter half-life, no dedicated obesity-dose approval
  • Tirzepatide (Mounjaro, Zepbound) — dual GIP/GLP-1 receptor agonist; produces greater mean weight loss than semaglutide in head-to-head Phase 3 comparisons
  • Retatrutide — triple GIP/GLP-1/glucagon receptor agonist in late-stage development; next-generation incretin approach
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does semaglutide reduce the urge to drink by quieting a brain reward signal triggered by alcohol cues, in a way that has nothing to do with losing weight?

If true, the weekly Ozempic/Wegovy injection could become a new treatment for alcohol use disorder, helping people avoid relapse even if they are not overweight. For the 280 million people worldwide affected by alcohol addiction, a drug with this already-established safety record could be a meaningful option where very few exist today.

The hypothesis
Semaglutide reduces risk of alcohol use disorder relapse in adults with established obesity or type 2 diabetes through a GLP-1R-mediated reduction in mesolimbic dopamine release triggered by alcohol cues, and this effect is independent of body weight reduction.
Why it’s plausible
The readme explicitly notes an exploratory signal for reduced alcohol consumption in a randomized trial in adults with alcohol use disorder. GLP-1 receptors are expressed in the nucleus accumbens and ventral tegmental area, key nodes of reward circuitry. The mechanism by which semaglutide could reduce alcohol intake - blunting cue-reactive dopamine surges - is distinct from the metabolic mechanism underlying weight loss and glucose control. If the effect is cue-reactivity suppression, it should persist even in lean individuals and should extend to other substances processed via the same mesolimbic pathway. This is distinct from the known weight-loss mechanism and represents a genuinely separable pharmacological property.
Why it matters
Alcohol use disorder affects over 280 million people globally. A weekly injectable with an established safety profile that also reduces relapse risk would be a significant treatment advance. More importantly, if the mechanism is GLP-1R-mediated dopamine modulation rather than weight loss, it would reposition semaglutide (or structural analogs without albumin binding) as a neuropsychiatric drug with a novel mechanism of action for addiction, opening entirely new indications.
Plausibility.73
Novelty.47
Impact.80
Basis · grounding2 computed/notes
[1]
noteOne randomized trial in adults with alcohol use disorder showed an exploratory signal for reduced alcohol consumption, noted as not a Phase 3 efficacy program.
[2]
noteGLP-1R biology and the reduction of Parkinson's disease risk (~30% lower, observational meta-analysis) imply CNS GLP-1R expression and function in neuronal populations beyond hypothalamus.
openupdated 2026-06-05

Does the oily side-chain on semaglutide lock the drug's receptor into a state that sends a stronger, longer "fullness" signal compared to related drugs that lack that chain?

If this mechanism is confirmed, drug designers could build next-generation weight-loss drugs by deliberately shaping that fatty side-chain rather than just tweaking how long the drug stays in the body. That could unlock treatments that work better, hit a higher weight-loss ceiling, and help the millions of people for whom current options are not effective enough.

The hypothesis
The C18 fatty diacid chain at K26 of semaglutide stabilizes a biased GLP-1R conformation that preferentially couples to Gs/cAMP over beta-arrestin-2 recruitment, and this signaling bias is the primary molecular basis for semaglutide's superior weight-loss efficacy relative to shorter-acting GLP-1 analogs with identical backbone sequences.
Why it’s plausible
Structural studies cited in the evidence confirm that semaglutide exhibits different receptor-peptide dynamics from native GLP-1, particularly involving the fatty acid chain and the receptor surface. The C18 chain does not appear in the stored backbone sequence (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG), yet it drives albumin binding and receptor residence time. Beta-arrestin recruitment is associated with receptor internalization and tolerance, while sustained Gs/cAMP signaling drives the satiety and weight effects. If the acyl chain physically contacts ECL2 or the receptor's lipid-facing surface in a way that disfavors beta-arrestin docking, the superior sustained efficacy of semaglutide over native GLP-1 would be mechanistically explained by signaling bias rather than simply half-life.
Why it matters
If confirmed, this would shift the design logic for next-generation GLP-1R agonists away from purely extending half-life and toward deliberately engineering acyl chain geometry to maximize Gs-bias. It would also explain the 15% mean body-weight loss plateau and why analogs with equivalent half-life but different acyl chain geometry show different efficacy ceilings.
Plausibility.52
Novelty.58
Impact.82
Basis · grounding2 papers · 1 computed/note
[1]
paper
Structural studies show semaglutide exhibits different receptor-peptide dynamics versus native GLP-1, particularly involving the fatty acid chain interaction with the receptor surface.
doi: 10.1038/s12276-025-01497-y
[2]
paper
Semaglutide engages non-canonical signaling via PI3K/AKT and mTOR through EPAC2, suggesting GLP-1R coupling is not limited to canonical Gs/cAMP and that coupling selectivity matters.
doi: 10.62051/5008za94
[3]
noteThe C18 fatty diacid chain at K26 enables albumin binding and is entirely absent from the stored backbone sequence, indicating it contributes pharmacological effects beyond half-life extension.
openupdated 2026-06-05

Does semaglutide protect brain cells only when enough healthy connections still remain, meaning it could prevent Alzheimer's but cannot reverse it once the disease is already established?

If this holds, the recent failed Alzheimer's trial would not mean the drug is useless for the brain; it would mean it was tested too late. People who are genetically at risk but still cognitively normal could potentially benefit from early treatment, representing a huge unmet need where no preventive options currently exist.

The hypothesis
Semaglutide's negative Phase 3 result in established Alzheimer's disease (EVOKE/EVOKE+) does not rule out GLP-1R agonism as a disease-modifying approach in pre-symptomatic or MCI-stage neurodegeneration; rather, GLP-1R agonism in the brain is neuroprotective only when amyloid burden is below a threshold where synaptic integrity is still preservable, making plasma amyloid-42/40 ratio a predictive biomarker for response.
Why it’s plausible
EVOKE/EVOKE+ enrolled adults with mild cognitive impairment or mild Alzheimer's disease. This population already has substantial amyloid and tau burden and significant synaptic loss. If semaglutide's CNS mechanism is anti-neuroinflammatory or synapse-protective (via cAMP/PKA signaling in neurons), it would be expected to fail when most synapses are already lost. The 30% reduced Parkinson's risk association (observational) is consistent with a preventive rather than therapeutic action. The EVOKE negative result therefore does not negate the neuroprotective hypothesis - it selects against the therapeutic (reversal) sub-hypothesis while leaving the preventive sub-hypothesis open. Plasma Abeta42/40 ratio differentiates high-amyloid from low-amyloid individuals and could identify a population where GLP-1R agonism would slow progression.
Why it matters
If true, this would reframe the EVOKE failure as a patient selection error rather than a target validation failure. It would support a prevention trial in cognitively normal APOE4 carriers or individuals with elevated amyloid on PET but no clinical symptoms, which is a massive unmet need. It would also prevent premature abandonment of the neurodegeneration indication for this class.
Plausibility.57
Novelty.48
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
noteEVOKE and EVOKE+ enrolled adults with mild cognitive impairment or mild Alzheimer's disease and reported no slowing of CDR-SB progression at topline readout November 2025.
[2]
noteA meta-analysis of 82 studies reports roughly 30% lower Parkinson's disease risk association for GLP-1 agonist class, described as not a semaglutide-specific causal finding, suggesting class-level CNS neuroprotection that may be preventive rather than therapeutic.
[3]
paper
Semaglutide and liraglutide have high selectivity for GLP-1R; liraglutide has higher steady-state concentration and receptor binding affinity, suggesting CNS penetration and receptor engagement differ between analogs, complicating cross-trial comparisons.
doi: 10.1186/s13195-024-01666-7
openupdated 2026-06-05

Does semaglutide directly block the liver cells that form scar tissue, in a way that works even in patients who do not lose much weight on the drug?

If the drug directly halts liver scarring rather than only helping through weight loss, it could work for a much broader group, including patients with advanced liver damage currently excluded from treatment, and those with liver disease caused by alcohol rather than obesity. That would expand a newly approved treatment to far more people who currently have no good options.

The hypothesis
Semaglutide reduces hepatic stellate cell activation and fibrosis progression in non-alcoholic fatty liver disease through a direct GLP-1R-mediated inhibition of TGF-beta1 signaling in hepatic stellate cells, independent of the indirect benefits from weight loss and steatosis reduction.
Why it’s plausible
The ESSENCE trial showed 63% MASH resolution versus 34% on placebo, and this formed the basis for the 2025 accelerated approval. The magnitude of MASH resolution exceeds what weight loss alone would predict. GLP-1R expression has been reported in hepatic stellate cells in rodent models, and GLP-1R agonism in stellate cells suppresses TGF-beta1-induced collagen synthesis via cAMP/PKA. If the direct anti-fibrotic mechanism is operative in humans, it would mean semaglutide is effective in MASH patients who achieve little weight loss (poor responders), and it would predict efficacy in other fibrotic liver conditions (e.g., alcohol-related liver disease fibrosis) where weight loss is not the primary driver. This is distinct from the currently approved MASH indication framing, which attributes effects primarily to metabolic improvement.
Why it matters
If GLP-1R agonism directly suppresses hepatic stellate cell activation, semaglutide's anti-fibrotic effect would extend to cirrhotic stages (currently excluded from the MASH approval) and to alcoholic hepatitis with fibrosis, representing a much larger patient population. It would also allow dose-response separation between the weight-loss dose and the anti-fibrotic dose, potentially enabling lower doses that avoid GI tolerability issues in liver-disease patients who are nutritionally vulnerable.
Plausibility.43
Novelty.53
Impact.75
Basis · grounding2 papers · 1 computed/note
[1]
noteESSENCE part 1 showed 63% MASH resolution versus 34% on placebo, forming the basis for the August 2025 FDA accelerated approval for non-cirrhotic MASH with stage 2-3 fibrosis.
[2]
paper
Liraglutide (a structural predecessor) suppresses macrophage foam cell formation and atherosclerosis, suggesting GLP-1 analogs have direct anti-inflammatory effects in non-pancreatic cell types.
doi: 10.3389/fendo.2019.00155
[3]
paper
Non-canonical signaling via PI3K/AKT and mTOR through EPAC2 contributes to beta-cell survival; analogous signaling in hepatic stellate cells could mediate anti-fibrotic effects via cAMP downstream of GLP-1R.
doi: 10.62051/5008za94
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.9244879484176636 boltz-2
ranking score 0.7912138104438782 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.866global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Semaglutide: Ozempic/Wegovy weight-loss & diabetes drug (pep-00016, v1). PeptideModel. https://peptidemodel.com/card/pep-00016
@peptide{pep00016,
  sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 703 on ct.gov · 95 on EUCTR · checked 2026-05-09
ct.gov trials 703
with results 99
EUCTR 95
PubMed RCT 313
by phase
1phase 13phase 32phase 44no phase
by status
4completed1recruiting1active1not yet recruiting1withdrawn2unknown
references 6 papers
[1] primary
[2]
Semaglutide as a Novel Therapeutic Agent for Obesity and Type 2 Diabetes
Chen Ruilin Transactions on Materials, Biotechnology and Life Sciences 2025
supporting
[3]
Once-Weekly Semaglutide in Adults with Overweight or Obesity
Wilding John P.H. et al. New England Journal of Medicine 2021
supporting
[4] supporting
[5] supporting
[6] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use