pe
pep-00017 v1 CC-BY-SA-4.0

Tirzepatide: Mounjaro/Zepbound weight-loss & diabetes drug

A once-weekly injectable drug that activates two appetite-regulating gut hormones to lower blood sugar and cause significant weight loss; FDA-approved for type 2 diabetes and obesity.

statusbioassayed targetGIPR length39 aa refs6
fda-approveddual-agonistglp-1-agonistweight-lossdiabetesgiprincretin
snapshot approved 92% confidence
Class
Dual GIP/GLP-1 receptor agonist
Status
FDA-approved prescription drug. Mounjaro (May 2022) for type 2 diabetes; Zepbound (November 2023) for chronic weight management; Zepbound (December 2024) for moderate-to-severe obstructive sleep apnea in adults with obesity. Additional approvals across EMA, MHRA, Health Canada, and Australia's TGA. Once-weekly subcutaneous injection.
Best-supported effect
Largest sustained weight reduction of any FDA-approved obesity medication in pivotal Phase III trials (~20–22% mean weight loss at 72 weeks at 15 mg in adults with obesity), with superiority over semaglutide 2.4 mg in SURMOUNT-5 head-to-head. Best-in-class HbA1c reduction in adults with type 2 diabetes (~2.0–2.4 percentage points across SURPASS program).
Main caveat
Pharmacological effect does not persist after discontinuation (SURMOUNT-4: ~14 percentage points regain over 52 weeks of placebo). Long-term (>2–3 years) outcome data, pediatric data, and direct comparisons against next-generation polyagonists (retatrutide, CagriSema) are not yet available. Compounded tirzepatide is not FDA-approved and is not bioequivalence-tested.
status 2 / 5 · 0 verified on platform
prediction metrics openfold3-mlx 0.3.1
ipTM0.777
pTM0.741
avg pLDDT54.8
ranking score0.840
STRUCTURE · PEP-00017 × GIPR
ranking0.840
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence39 aa
1510152025303539
YAEGTFTSDYSIA LDKIAQKAFVQWL IAGGPSSGAPPPS
in the news 264 articles
overview readme

What this is

Tirzepatide is a once-weekly injectable medication that simultaneously activates two appetite-regulating gut hormones — GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) — making it the first approved dual agonist of both receptors. Eli Lilly markets it under two brand names with identical active ingredient: Mounjaro for type 2 diabetes and Zepbound for chronic weight management and obstructive sleep apnea in adults with obesity. As of early 2026, it holds the record for the largest sustained weight reduction observed in pivotal Phase III trials among FDA-approved obesity medications.

The 39-amino-acid backbone is engineered with a C-20 fatty diacid modification that binds albumin and extends the molecule's half-life to approximately five days, enabling once-weekly subcutaneous dosing. The platform-stored sequence (YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS) represents the standard-letter approximation of the backbone; two positions in the published peptide chemistry carry non-standard residues, and the C-20 fatty diacid chain attached at Lys20 is absent from the raw string — the full modification detail is the authoritative Eli Lilly published chemistry.


History

Tirzepatide emerged from Eli Lilly's incretin program in the mid-2010s as the first-in-class dual agonist engineered to activate both the GIP and GLP-1 receptors with a single molecule. The design drew on decades of native-incretin biology: GIP and GLP-1 are co-secreted from the gut after meals, and earlier attempts at GIP monotherapy had yielded disappointing metabolic results — but combined activation in rodent and primate studies produced synergistic weight loss and glycemic improvement beyond what either agonist achieved alone. The compound was first reported by Eli Lilly in 2018 (then designated LY3298176).

The five-trial SURPASS Phase III program established FDA approval of Mounjaro for type 2 diabetes in May 2022. The SURMOUNT program then advanced the molecule into chronic weight management: SURMOUNT-1 (n=2,539) drove Zepbound's FDA approval in November 2023, and SURMOUNT-5 — the head-to-head trial against semaglutide 2.4 mg — confirmed tirzepatide's superiority (20.2% vs 13.7% mean weight loss at 72 weeks) in late 2024. A third Zepbound indication for moderate-to-severe obstructive sleep apnea in adults with obesity was granted by the FDA in December 2024 (SURMOUNT-OSA). By Q3 2025, tirzepatide had become the world's best-selling drug by revenue.


What it does

Tirzepatide works by activating two overlapping appetite-control circuits at once. On the GLP-1 side, it slows gastric emptying, boosts meal-stimulated insulin, suppresses glucagon, and engages satiety pathways in the brain — the same effects produced by semaglutide and other GLP-1 receptor agonists. The added GIP receptor activation contributes to improved insulin sensitivity in adipose tissue, enhanced beta-cell function, and additional appetite signaling in the hypothalamus that the GLP-1 pathway alone does not fully reach.

The clinical outcome of this dual mechanism is a larger effect size than selective GLP-1 agonists produce. In people with obesity, the pivotal trials showed mean weight losses of 15–22.5% at 72 weeks depending on dose and population. In people with type 2 diabetes, HbA1c reductions of approximately 2.0–2.4 percentage points were observed across the SURPASS program — best-in-class among approved agents in that setting. In adults with obesity and obstructive sleep apnea, the SURMOUNT-OSA trial demonstrated dramatic reductions in apnea-hypopnea index sufficient to support a new regulatory label. In adults with obesity and heart failure with preserved ejection fraction (HFpEF), the SUMMIT trial reported a hazard ratio of 0.62 for cardiovascular death or worsening heart failure.


Evidence

  • Human: Extensive Phase III evidence across two large clinical programs. The five SURMOUNT trials in obesity and the five SURPASS trials in type 2 diabetes together enroll tens of thousands of participants. SURMOUNT-1 (Jastreboff et al., NEJM 2022) reported a mean 22.5% body-weight reduction at 15 mg over 72 weeks versus 3.1% on placebo (n=2,539). SURMOUNT-3 (Wadden et al., Nature Medicine 2023) reported 26.6% mean weight loss when combined with intensive lifestyle intervention. SURMOUNT-4 demonstrated that stopping tirzepatide after 36 weeks of titration resulted in approximately 14 percentage points of weight regain over the following 52 weeks, establishing that the pharmacological effect does not persist after discontinuation. SURMOUNT-5 (Aronne et al., NEJM 2024) reported a 6.5 percentage-point difference in mean weight loss versus semaglutide 2.4 mg (20.2% vs 13.7%) in adults with obesity at 72 weeks. SURPASS-2 (Frías et al., NEJM 2021) reported HbA1c reductions of 2.01–2.30 percentage points versus 1.86 percentage points for semaglutide 1 mg over 40 weeks in adults with type 2 diabetes. SURPASS-CVOT (Lincoff et al., NEJM 2025) established non-inferiority to dulaglutide for three-point MACE in adults with type 2 diabetes and atherosclerotic cardiovascular disease, with an expanded MACE hazard ratio of 0.88 favouring tirzepatide. SUMMIT (Packer et al., NEJM 2024) reported HR 0.62 for cardiovascular death or worsening heart failure versus placebo in adults with HFpEF and obesity (n=731), and a Kansas City Cardiomyopathy Questionnaire clinical summary score improvement of +6.9 points. A body-composition substudy of SURMOUNT-1 found that approximately 25–30% of total weight loss was lean mass without resistance training — a proportion similar to semaglutide. The published evidence base also includes approximately 30 systematic reviews and network meta-analyses pooling tirzepatide data across efficacy, safety, cardiovascular outcomes, and comparative-effectiveness questions. A large share of the clinical evidence is concentrated in Eli Lilly-sponsored trials; independent academic replication exists primarily through those meta-analyses.
  • Animal: Comprehensive preclinical program in rodent and primate models established the synergistic weight-loss and glycemic effects of dual GIP/GLP-1 agonism prior to clinical development. Detailed individual animal study results are not extracted from the available sources.
  • In vitro: Receptor pharmacology of dual GIP/GLP-1 agonism is well-characterised. The molecule is described in available literature as an imbalanced and biased dual agonist, with greater affinity at the GIP receptor than at the GLP-1 receptor (JCI Insight 2020).

Known effects

  • Weight reduction (chronic weight management) — FDA-approved (Zepbound). Mean 15–22.5% body-weight reduction at 72 weeks in Phase III trials across SURMOUNT program. Superiority over semaglutide 2.4 mg confirmed in SURMOUNT-5 head-to-head.
  • Glycaemic control (type 2 diabetes) — FDA-approved (Mounjaro). HbA1c reductions of approximately 2.0–2.4 percentage points at maintenance doses across SURPASS trials; best-in-class versus comparators in network meta-analyses.
  • Obstructive sleep apnea severity reduction — FDA-approved (Zepbound, December 2024). Apnea-hypopnea index reduction in SURMOUNT-OSA.
  • Heart failure outcomes (HFpEF + obesity) — Phase III (SUMMIT). HR 0.62 for cardiovascular death or worsening heart failure; KCCQ-CSS improvement +6.9 points. Single completed trial; broader HFpEF outcome confirmation pending.
  • Cardiovascular event reduction (T2D + ASCVD) — Phase III CVOT (SURPASS-CVOT). Non-inferiority to dulaglutide for 3-point MACE; expanded MACE HR 0.88 favoured tirzepatide.
  • Blood pressure and lipid reduction — Phase III (across SURPASS and SURMOUNT programs). Tirzepatide was the most effective agent for lowering systolic blood pressure in obesity populations in network meta-analyses.
  • Liver fat reduction (MASLD/MASH) — Phase III (SYNERGY-NASH). Superior liver fat reduction and higher MASH resolution rates versus placebo and versus semaglutide in available meta-analyses. Regulatory and labelling implications not yet resolved as of early 2026.
  • Diabetes prevention (obesity with prediabetes) — Phase III. Reduction in conversion from prediabetes to type 2 diabetes in adults with obesity; trial completed and published.
  • Body composition — lean mass loss — Phase III substudy. Approximately 25–30% of total weight loss is lean mass without resistance training; similar pattern to semaglutide. Not an adverse effect in the regulatory sense, but a clinically relevant composition finding.

Myths and misconceptions

"Tirzepatide is just a stronger version of semaglutide." Tirzepatide has a mechanistically distinct profile: it activates both the GIP receptor and the GLP-1 receptor, while semaglutide activates only GLP-1. The dual agonism is why SURMOUNT-5 showed a 6.5 percentage-point difference in weight loss (20.2% vs 13.7%). "Stronger" captures the clinical outcome but misrepresents the pharmacology — the GIP component produces effects on adipose tissue and energy handling that a selective GLP-1 agonist cannot replicate.

"More weight loss means worse side effects." Head-to-head comparisons and meta-analyses show broadly comparable incidence of gastrointestinal adverse events between tirzepatide and semaglutide. Tirzepatide's superior efficacy does not come at a proportionally higher GI cost, though individual patients may tolerate one molecule better than the other and specific symptom profiles differ (e.g., sulfur eructation reported as more prominent with tirzepatide).

"Compounded tirzepatide from online pharmacies is the same drug as Zepbound." Compounded tirzepatide is not FDA-approved, is not bioequivalence-tested, and its active pharmaceutical ingredient may include salt forms or impurities not present in branded Mounjaro or Zepbound. With the FDA declaring the branded shortage resolved in October 2024, much ongoing compounding falls outside the narrow legal 503A pathway.

"Once you reach your goal weight on tirzepatide you can stop and keep the results." SURMOUNT-4 directly tested this: participants who stopped after 36 weeks of titration regained approximately 14 percentage points of body weight over the following 52 weeks, while those who continued tirzepatide lost additional weight. The pharmacological effect does not persist after discontinuation.


Safety signals

Gastrointestinal adverse events are the dominant tolerability signal across Phase III trials. The four-week dose-escalation cadence is designed to improve GI tolerability; symptoms typically concentrate in the first week after each dose increase and attenuate thereafter.

SignalEvidence contextNotes
NauseaFDA label and Phase III trialsMost common adverse event; dose-dependent
DiarrheaFDA label and Phase III trialsCommon; broadly comparable to semaglutide in head-to-head comparisons
VomitingFDA label and Phase III trialsCommon; concentrates around dose escalations
ConstipationFDA label and Phase III trialsCommon
Sulfur eructation ("sulfur burps")Phase III trials and post-marketing reportsReported as more pronounced than with semaglutide; typically improves with titration
Injection-site reactionsPhase III trials and post-marketingGenerally mild; rotation of injection sites recommended
PancreatitisClass-level signal in FDA labelCarried in tirzepatide label; post-marketing surveillance ongoing
Gallbladder events (cholelithiasis, cholecystitis)Phase III trials and meta-analysesClass-level signal; characterised in a specific tirzepatide safety meta-analysis
Medullary thyroid C-cell tumourBoxed warning shared across the incretin classBased on rodent C-cell tumour findings; no confirmed human signal established
Lean mass loss (~25–30% of weight lost)DEXA data, SURMOUNT-1 body-composition substudySimilar pattern to semaglutide; role of resistance training not characterised in trials
Long-term safety (>2–3 years)Phase III extension dataPublished continuous exposure capped at approximately 88 weeks; chronic-use surveillance beyond this window not yet available

Label safety exclusions per FDA label: Personal or family history of medullary thyroid carcinoma; Multiple Endocrine Neoplasia syndrome type 2; prior serious hypersensitivity reaction to tirzepatide or formulation components; active or recurrent pancreatitis (label caution); pregnancy (animal reproductive toxicity data; label advises discontinuation before planned conception); breastfeeding (transfer into human milk not adequately characterised); severe gastroparesis or significant gastrointestinal motility disorders; use under age 18 (not approved in paediatric populations as of early 2026).


Regulatory status

Region / bodyStatusNotes
US — FDA (Mounjaro)Approved May 2022Adults with type 2 diabetes
US — FDA (Zepbound)Approved November 2023Adults with obesity, or overweight with at least one weight-related comorbidity
US — FDA (Zepbound)Approved December 2024Moderate-to-severe obstructive sleep apnea in adults with obesity
US — FDA (Zepbound KwikPen)Approved February 2026Multi-dose autoinjector pen format
US — FDA (compounding)Shortage resolved October 2024Most 503A compounding substantially restricted by subsequent FDA enforcement and litigation; state-level clinical compounding under personalised-prescription carve-outs continues in some jurisdictions and remains legally unsettled as of early 2026
US — Medicare Part DCoverage expanding April 2026Lilly–US Government BALANCE agreement (announced November 2025); Medicare Part D copay capped at $50/month for Zepbound starting April 2026
US — genericsNonePatent protection runs into the 2030s
EU — EMAApproved (Mounjaro, 2022)Separate authorisation for obesity indication
UK — MHRAApprovedNHS obesity access restricted by NICE criteria
Canada — Health CanadaApprovedParallel indications
Australia — TGAApprovedParallel indications
WADANot currently listed by name on the WADA Prohibited ListWADA has signalled rising scrutiny of GLP-1/GIP agonists in weight-category and endurance sports; athletes subject to anti-doping regulation should verify current status before use

Mechanism

Tirzepatide is a 39-amino-acid synthetic peptide that simultaneously activates the GIP receptor (GIPR) and the GLP-1 receptor (GLP-1R). Available literature consistently identifies GIPR as the primary differentiator from semaglutide, while the dual mechanism produces synergistic rather than merely additive metabolic effects (JCI Insight, 2020).

GLP-1 receptor activation reproduces the established class effects: slowed gastric emptying, enhanced meal-stimulated insulin secretion, suppressed glucagon, and engagement of central satiety pathways via hypothalamic and brainstem circuits. GIP receptor activation contributes additional mechanisms in adipose tissue (improved insulin sensitivity and altered lipid handling), in pancreatic beta cells (potentially enhanced beta-cell function and preserved insulin secretory capacity), and in central appetite and food-preference circuits. A distinct effect on food preference — particularly diminished appetite for high-fat and high-palatability foods — is reported more prominently for tirzepatide than for selective GLP-1 agonists and is attributed to the GIP component.

The molecule has greater affinity at the GIP receptor than at the GLP-1 receptor and is described in the pharmacological literature as an imbalanced and biased dual agonist (JCI Insight 2020). The C-20 fatty diacid modification on the backbone enables albumin binding, providing the approximately 5-day half-life and once-weekly subcutaneous dosing — a half-life consistent across available literature including the management review in Diabetologia (2022).

The synergy of dual agonism is the proposed basis for the larger clinical effect size. SURMOUNT-5 demonstrated a 6.5 percentage-point difference in mean weight loss versus semaglutide 2.4 mg at 72 weeks; the SURPASS program showed best-in-class HbA1c reductions among approved agents in adults with type 2 diabetes (mean difference approximately −2.10 percentage points vs placebo, 95% CI −2.47 to −1.74 in one network meta-analysis). The mechanistic contributions of GIPR agonism to adipose-tissue insulin sensitivity and beta-cell function in humans are supported by dual incretin biology; their direct quantitative contribution to clinical outcomes has not been disentangled in published trials.


Open questions

  • Long-term outcomes (>2–3 years). Published continuous Phase III exposure data are capped at approximately 88 weeks (SURMOUNT-1 extension and SURMOUNT-4). Five-year-plus data on sustained weight maintenance, cardiovascular events, and durability of HbA1c effect are not yet published.
  • Paediatric efficacy and safety. Not approved in patients under 18. Adolescent trials are early-stage relative to the liraglutide and semaglutide adolescent programs; no paediatric efficacy or safety data are available in the published literature.
  • Comparative effectiveness vs next-generation polyagonists. Direct head-to-head data against retatrutide (triple GLP-1/GIP/glucagon agonist) and other emerging candidates are not yet published. Whether tirzepatide's efficacy ceiling is matched or exceeded is an open question.
  • Body composition optimisation. Approximately 25–30% of total weight loss is lean mass without resistance training (similar to semaglutide). Whether structured resistance training, dietary protein optimisation, or specific co-interventions reduce the lean-mass fraction of weight loss is not characterised in available trials.
  • MASH and label-expansion lanes. SYNERGY-NASH showed superior liver fat reduction in MASLD. Final regulatory and labelling implications, and broader cardiovascular/MASH outcome integration, are not yet resolved as of early 2026.
  • Cardiovascular outcomes outside SURPASS-CVOT and SUMMIT. Agent-level cardiovascular benefit is established in adults with type 2 diabetes and ASCVD, and in HFpEF with obesity. Broader long-term cardiovascular outcomes in primary-prevention obesity populations without diabetes or HFpEF are still accumulating.

Related peptides

  • Semaglutide — GLP-1 receptor agonist (Ozempic/Wegovy/Rybelsus); the most direct predecessor and the active comparator in SURMOUNT-5 and SURPASS-2. Tirzepatide's dual GIP/GLP-1 mechanism consistently shows larger weight reduction versus semaglutide 2.4 mg in head-to-head data.
  • Retatrutide — triple GLP-1/GIP/glucagon receptor agonist currently in Phase III; the next-generation candidate against which tirzepatide's efficacy ceiling will eventually be measured. No card yet.
  • Liraglutide — daily GLP-1 receptor agonist (Victoza/Saxenda); the first-generation incretin in the same therapeutic space; now largely superseded by semaglutide and tirzepatide in terms of clinical adoption. No card yet.
Hypotheses6 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could Tirzepatide work better than older drugs because it triggers a different kind of cellular signal, not just because it hits two receptors?

If true, this insight could help chemists design future drugs that produce more weight loss with fewer side effects, and help doctors predict which patients will respond best.

The hypothesis
Tirzepatide activates GIPR and GLP-1R with a biased agonism profile that favors cAMP signaling over beta-arrestin recruitment differently at each receptor, and this bias ratio, not simply dual occupancy, is the primary determinant of superior weight loss compared with balanced agonists.
Why it’s plausible
GLP-1R biased agonism (cAMP-preferring vs. beta-arrestin-recruiting) is known to affect receptor internalization, desensitization, and downstream metabolic outcomes. Tirzepatide's engineered backbone deviates from native GIP at several positions, and native GIP itself has a distinct bias profile from GLP-1. If Tirzepatide imposes a specific cAMP-over-arrestin bias at GIPR while maintaining moderate GLP-1R activation, the net downstream signaling could be qualitatively, not merely quantitatively, different from co-administration of two monoagonists, explaining clinical superiority.
Why it matters
If bias profile rather than simple dual occupancy explains clinical outcomes, rational bias engineering at GIPR and GLP-1R could unlock incretin drugs with better efficacy-to-side-effect ratios and guide which patients benefit most.
Plausibility.70
Novelty.55
Impact.75
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Radioligand binding Bmax values and receptor-per-cell calculations for incretin receptors establish that receptor number and binding capacity vary across tissues, creating the substrate for tissue-selective biased signaling outcomes.
doi: 10.1172/jci.insight.140532
[2]
sequenceTirzepatide sequence deviates from native GIP (e.g., position 2 substitution hinted at in the readme regarding non-standard residues), altering the pharmacophore in ways that could impose specific G-protein vs. arrestin coupling geometry at GIPR.
[3]
noteTirzepatide achieves greater weight loss than semaglutide (a highly optimized GLP-1R agonist), consistent with a qualitative, not merely additive, pharmacological difference.
openupdated 2026-06-05

Does activating the GIP receptor on fat cells help the body burn stored fat, separate from making people feel full?

If true, this would explain why Tirzepatide causes more weight loss than older drugs and could help scientists design even better treatments that target fat tissue directly, benefiting people who struggle to lose weight through appetite control alone.

The hypothesis
Tirzepatide's GIP receptor agonism contributes independently to weight loss beyond GLP-1R activation, partly through direct action on adipocyte GIPR to promote lipid oxidation rather than solely through central appetite suppression.
Why it’s plausible
Native GIP is known to act on adipose tissue GIPR to regulate lipid metabolism. Tirzepatide achieves greater weight loss than selective GLP-1R agonists (e.g., semaglutide) in head-to-head trials. The excess weight loss above GLP-1R monotherapy implies a GIPR-mediated peripheral metabolic component. Radioligand binding data confirm meaningful GIPR receptor densities in non-pancreatic tissues. If adipocyte GIPR agonism drives fatty acid oxidation or reduces lipid storage directly, this would be a mechanism independent of satiety signaling.
Why it matters
Identifying adipose GIPR as a bona fide weight-loss effector would validate a new therapeutic axis and explain why dual agonism outperforms GLP-1 alone, guiding next-generation incretin design.
Plausibility.75
Novelty.35
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Radioligand binding Bmax data establish quantitative GIPR receptor densities in peripheral cell membranes, consistent with meaningful GIPR expression in non-pancreatic tissues including adipose.
doi: 10.1172/jci.insight.140532
[2]
sequenceSequence contains Lys20 (position for fatty diacid in the full molecule), conferring albumin binding and extended half-life that sustains peripheral tissue exposure well beyond meal-time GIP pulses.
[3]
noteTirzepatide holds the record for largest sustained weight reduction among FDA-approved obesity drugs, exceeding selective GLP-1R agonists, implying GIPR contributes a distinct weight-loss component.
openupdated 2026-06-05

Could Tirzepatide, already approved for diabetes and obesity, also slow the brain-cell damage that causes Parkinson's disease?

If true, millions of Parkinson's patients, who currently have no drugs that stop disease progression, might benefit from a treatment already known to be safe in humans, potentially reaching patients much faster than a brand-new drug.

The hypothesis
Tirzepatide's dual GIP/GLP-1R agonism slows neurodegeneration in Parkinson's disease models by reducing neuroinflammation and oxidative stress through mechanisms already documented for GIP analogues in dopaminergic neurons.
Why it’s plausible
A GIP analogue ([D-Ala2]GIP) reduced chronic neuroinflammation, oxidative stress, and lipid peroxidation in a low-dose MPTP mouse model considered realistic for Parkinson's disease. Tirzepatide activates GIPR with high potency and, unlike [D-Ala2]GIP, also engages GLP-1R, which has its own neuroprotective literature. The combination of both receptor activations in a single molecule with a five-day half-life could provide sustained neuroprotection superior to either agonist alone.
Why it matters
Parkinson's disease lacks disease-modifying drugs. Repurposing an already-approved, well-tolerated peptide with dual incretin activity could compress the development timeline for a neurological indication substantially.
Plausibility.60
Novelty.40
Impact.80
Basis · grounding1 paper · 2 computed/notes
[1]
paper
[D-Ala2]GIP reduced neuroinflammation, oxidative stress, and lipid peroxidation in a low-dose MPTP Parkinson's mouse model, directly implicating GIPR activation in dopaminergic neuroprotection.
doi: 10.1016/j.molmet.2025.102118
[2]
noteTirzepatide activates both GIPR and GLP-1R; GLP-1R agonists (e.g., liraglutide, semaglutide) have shown neuroprotective signals in Parkinson's clinical and preclinical studies, suggesting additive potential.
[3]
sequenceThe 39-aa backbone with albumin-binding fatty diacid at Lys20 gives a ~5-day half-life, potentially maintaining steady CNS receptor engagement superior to short-acting GIP analogues tested preclinically.
openupdated 2026-06-05

Could engineering the non-functional end of Tirzepatide to form a slow-release depot under the skin replace the need for weekly injections?

If true, people managing diabetes or obesity could switch from weekly injections to monthly ones, making the treatment far easier to stick with and potentially opening the door to new patients who struggle with frequent dosing.

The hypothesis
Replacing the C-terminal polyproline tail of Tirzepatide with a structured peptide amphiphile self-assembly domain would create a depot-forming injectable that slowly releases active dual agonist locally, achieving month-long pharmacokinetics without albumin conjugation and potentially lower peak-concentration side effects.
Why it’s plausible
The GGPSSGAPPPS tail is disordered and does not directly contact either receptor based on structure prediction (low pLDDT for this region). Self-assembling peptide amphiphiles typically require a beta-sheet or coiled-coil motif at the C-terminus. Replacing the tail with such a motif while retaining the N-terminal GIP/GLP-1R pharmacophore and the Lys20 lipid (now redirected from albumin to amphiphile hydrophobic core) could create nanofiber depot systems. This would shift the half-life extension mechanism from albumin circulation to slow dissolution from a subcutaneous depot.
Why it matters
Monthly or quarterly dosing would dramatically improve patient adherence over weekly injections. Avoiding albumin binding could also alter tissue distribution, potentially improving CNS penetration for neurological indications.
Plausibility.40
Novelty.75
Impact.60
Basis · grounding3 computed/notes
[1]
sequencePositions 29-39 (GGPSSGAPPPS) are proline/glycine-rich and disordered; they are structurally dispensable for receptor binding and represent a modular engineering insertion point.
[2]
structurepLDDT=54.8 and ipTM=0.77: the low confidence in the C-terminal tail confirms it is not a structured receptor-contact region, supporting its replaceability without disrupting pharmacophore integrity.
[3]
noteCurrent half-life extension relies on C-20 fatty diacid albumin binding at Lys20; an alternative depot strategy decoupled from albumin could unlock new tissue distribution profiles and dosing intervals.
openupdated 2026-06-05

Could activating two gut hormone receptors at once help the remaining intestine grow and work better after large portions are surgically removed?

If true, people with short bowel syndrome, who must receive nutrition through IV lines for life, could potentially eat normally or reduce their dependence on intravenous feeding, dramatically improving their daily lives.

The hypothesis
Tirzepatide's combined GIP and GLP-1R agonism reduces intestinal adaptation failure in short bowel syndrome by simultaneously promoting GLP-2-like trophic signaling (via GLP-1R-adjacent pathways) and GIPR-mediated nutrient absorption enhancement, reducing dependence on parenteral nutrition.
Why it’s plausible
GLP-2 is the key trophic factor for intestinal adaptation in short bowel syndrome, and GLP-1 and GLP-2 are co-secreted from the same L-cells. GLP-1R agonism indirectly modulates the GLP-2 axis. GIPR agonism has independent effects on nutrient absorption and intestinal motility. Tirzepatide's dual activation could synergize to promote mucosal growth and absorptive capacity in the remnant bowel. The literature excerpt describing three anatomical SBS groups implies heterogeneity in which receptor axis is most relevant, and Tirzepatide's dual mechanism might cover more patient subgroups than a GLP-2 analogue alone.
Why it matters
Short bowel syndrome patients face lifelong parenteral nutrition dependency. An approved dual incretin agonist repurposed for intestinal rehabilitation would represent a major quality-of-life gain for a rare but severely affected population.
Plausibility.35
Novelty.70
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Review identifies three anatomical short bowel syndrome groups with distinct intestinal remnants, highlighting heterogeneity in adaptation capacity and implying multiple receptor axes are relevant across patient types.
doi: 10.1152/physrev.00057.2024
[2]
noteTirzepatide activates GLP-1R; GLP-1 and GLP-2 are co-products of proglucagon processing in intestinal L-cells, and GLP-1R agonism is known to modulate L-cell secretion patterns including downstream GLP-2 availability.
[3]
sequenceFive-day half-life (from albumin-binding modification at Lys20) would provide continuous trophic receptor stimulation across the remnant intestinal mucosa, unlike short-acting native peptides.
openupdated 2026-06-05

Could the apparently purposeless floppy end of the drug molecule be what allows it to hit two different receptors at once?

If true, drug designers could engineer the next generation of weight-loss drugs by tweaking this tail to precisely dial up or down each receptor, potentially reducing side effects or improving weight loss for specific patient groups.

The hypothesis
The polyproline-rich C-terminal tail (GGPSSGAPPPS) of Tirzepatide functions as a conformational spacer that prevents the helical GIP-mimicking N-terminus from burying the albumin-binding fatty acid chain against receptor surfaces, and removing or truncating this tail would shift receptor selectivity toward GLP-1R.
Why it’s plausible
The sequence contains a striking proline/glycine/serine-rich C-terminal segment (positions 29-39: GGPSSGAPPPS). Proline residues are helix-breakers; this region likely remains disordered, keeping the fatty diacid at Lys20 solvent-exposed for albumin binding while the N-terminal helix engages receptors. Removing this spacer could force closer packing of the lipid tail with receptor transmembrane helices, sterically disfavoring GIPR (which has a distinct extracellular domain geometry relative to GLP-1R). The ipTM of 0.77 for the complex prediction is reasonable but pLDDT of 54.8 is low, consistent with a largely disordered C-terminus in isolation.
Why it matters
Understanding how a disordered tail sculpts dual-receptor selectivity would provide a rational design rule for tuning incretin agonist bias without changing the pharmacophore region.
Plausibility.35
Novelty.70
Impact.50
Basis · grounding3 computed/notes
[1]
sequencePositions 29-39 (GGPSSGAPPPS) contain 4 prolines and 2 glycines in 11 residues, a composition characteristic of intrinsically disordered regions incompatible with stable secondary structure.
[2]
structurepLDDT=54.8 globally and ipTM=0.77 for the complex; low pLDDT is consistent with the C-terminal tail being disordered and contributing little to direct receptor contacts.
[3]
noteFatty diacid modification at Lys20 is required for albumin binding and once-weekly dosing; the tail immediately C-terminal to Lys20 likely controls whether the lipid chain is accessible to albumin vs. receptor surfaces.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.7772039175033569 openfold3-mlx
ranking score 0.8402016162872314 openfold3-mlx
▸structural qualityopenfold3
metricvaluenote
gpde0.697global PDE — lower = better
disorder0.141fraction disordered
chain pair ipTM (A, B)0.777interface quality
▸3-letter notation
Tyr-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-Ala-Leu-Asp-Lys-Ile-Ala-Gln-Lys-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
runtime445s
predicted bymlx@peptide
predicted at2026-04-14
▸citationbibtex
peptidemodel (2026). Tirzepatide: Mounjaro/Zepbound weight-loss & diabetes drug (pep-00017, v1). PeptideModel. https://peptidemodel.com/card/pep-00017
@peptide{pep00017,
  sequence = {YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
clinical trials 245 on ct.gov · 13 on EUCTR · checked 2026-05-09
ct.gov trials 245
with results 45
EUCTR 13
PubMed RCT 160
by phase
1phase 13phase 22phase 32phase 42no phase
by status
2completed5recruiting1active2withdrawn
references 1 papers · 5 non-peer
[1]
Tirzepatide Once Weekly for the Treatment of Obesity
Ania M. Jastreboff, Louis J. Aronne, Nadia N. Ahmad, Sean Wharton, et al. New England Journal of Medicine 2022
[2]
Tirzepatide is an imbalanced and biased dual GIP and GLP-1 receptor agonist
Francis S. Willard, Jonathan D. Douros, Maria B.N. Gabe, Aaron D. Showalter, et al. JCI Insight 2020
[3]
Proglucagon-derived peptides: human physiology and therapeutic potential
Lærke S. Gasbjerg, Casper K. Nielsen, Malte P. Suppli, Magnus F. G. Grøndahl, et al. Physiological Reviews 2026
[4]
Glucose-dependent insulinotropic polypeptide (GIP)
Timo D. Müller, Alice Adriaenssens, Bo Ahrén, Matthias Blüher, et al. Molecular Metabolism 2025
[6] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use