Tirzepatide: Mounjaro/Zepbound weight-loss & diabetes drug
A once-weekly injectable drug that activates two appetite-regulating gut hormones to lower blood sugar and cause significant weight loss; FDA-approved for type 2 diabetes and obesity.
- Class
- Dual GIP/GLP-1 receptor agonist
- Status
- FDA-approved prescription drug. Mounjaro (May 2022) for type 2 diabetes; Zepbound (November 2023) for chronic weight management; Zepbound (December 2024) for moderate-to-severe obstructive sleep apnea in adults with obesity. Additional approvals across EMA, MHRA, Health Canada, and Australia's TGA. Once-weekly subcutaneous injection.
- Best-supported effect
- Largest sustained weight reduction of any FDA-approved obesity medication in pivotal Phase III trials (~20–22% mean weight loss at 72 weeks at 15 mg in adults with obesity), with superiority over semaglutide 2.4 mg in SURMOUNT-5 head-to-head. Best-in-class HbA1c reduction in adults with type 2 diabetes (~2.0–2.4 percentage points across SURPASS program).
- Main caveat
- Pharmacological effect does not persist after discontinuation (SURMOUNT-4: ~14 percentage points regain over 52 weeks of placebo). Long-term (>2–3 years) outcome data, pediatric data, and direct comparisons against next-generation polyagonists (retatrutide, CagriSema) are not yet available. Compounded tirzepatide is not FDA-approved and is not bioequivalence-tested.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
FDA-approved drug — commercial manufacture documented
Fork this card to add platform evidence →
FDA-approved — Phase 3 efficacy and receptor activity established
Fork this card to add platform evidence →
What this is
Tirzepatide is a once-weekly injectable medication that simultaneously activates two appetite-regulating gut hormones — GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) — making it the first approved dual agonist of both receptors. Eli Lilly markets it under two brand names with identical active ingredient: Mounjaro for type 2 diabetes and Zepbound for chronic weight management and obstructive sleep apnea in adults with obesity. As of early 2026, it holds the record for the largest sustained weight reduction observed in pivotal Phase III trials among FDA-approved obesity medications.
The 39-amino-acid backbone is engineered with a C-20 fatty diacid modification that binds albumin and extends the molecule's half-life to approximately five days, enabling once-weekly subcutaneous dosing. The platform-stored sequence (YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS) represents the standard-letter approximation of the backbone; two positions in the published peptide chemistry carry non-standard residues, and the C-20 fatty diacid chain attached at Lys20 is absent from the raw string — the full modification detail is the authoritative Eli Lilly published chemistry.
History
Tirzepatide emerged from Eli Lilly's incretin program in the mid-2010s as the first-in-class dual agonist engineered to activate both the GIP and GLP-1 receptors with a single molecule. The design drew on decades of native-incretin biology: GIP and GLP-1 are co-secreted from the gut after meals, and earlier attempts at GIP monotherapy had yielded disappointing metabolic results — but combined activation in rodent and primate studies produced synergistic weight loss and glycemic improvement beyond what either agonist achieved alone. The compound was first reported by Eli Lilly in 2018 (then designated LY3298176).
The five-trial SURPASS Phase III program established FDA approval of Mounjaro for type 2 diabetes in May 2022. The SURMOUNT program then advanced the molecule into chronic weight management: SURMOUNT-1 (n=2,539) drove Zepbound's FDA approval in November 2023, and SURMOUNT-5 — the head-to-head trial against semaglutide 2.4 mg — confirmed tirzepatide's superiority (20.2% vs 13.7% mean weight loss at 72 weeks) in late 2024. A third Zepbound indication for moderate-to-severe obstructive sleep apnea in adults with obesity was granted by the FDA in December 2024 (SURMOUNT-OSA). By Q3 2025, tirzepatide had become the world's best-selling drug by revenue.
What it does
Tirzepatide works by activating two overlapping appetite-control circuits at once. On the GLP-1 side, it slows gastric emptying, boosts meal-stimulated insulin, suppresses glucagon, and engages satiety pathways in the brain — the same effects produced by semaglutide and other GLP-1 receptor agonists. The added GIP receptor activation contributes to improved insulin sensitivity in adipose tissue, enhanced beta-cell function, and additional appetite signaling in the hypothalamus that the GLP-1 pathway alone does not fully reach.
The clinical outcome of this dual mechanism is a larger effect size than selective GLP-1 agonists produce. In people with obesity, the pivotal trials showed mean weight losses of 15–22.5% at 72 weeks depending on dose and population. In people with type 2 diabetes, HbA1c reductions of approximately 2.0–2.4 percentage points were observed across the SURPASS program — best-in-class among approved agents in that setting. In adults with obesity and obstructive sleep apnea, the SURMOUNT-OSA trial demonstrated dramatic reductions in apnea-hypopnea index sufficient to support a new regulatory label. In adults with obesity and heart failure with preserved ejection fraction (HFpEF), the SUMMIT trial reported a hazard ratio of 0.62 for cardiovascular death or worsening heart failure.
Evidence
- Human: Extensive Phase III evidence across two large clinical programs. The five SURMOUNT trials in obesity and the five SURPASS trials in type 2 diabetes together enroll tens of thousands of participants. SURMOUNT-1 (Jastreboff et al., NEJM 2022) reported a mean 22.5% body-weight reduction at 15 mg over 72 weeks versus 3.1% on placebo (n=2,539). SURMOUNT-3 (Wadden et al., Nature Medicine 2023) reported 26.6% mean weight loss when combined with intensive lifestyle intervention. SURMOUNT-4 demonstrated that stopping tirzepatide after 36 weeks of titration resulted in approximately 14 percentage points of weight regain over the following 52 weeks, establishing that the pharmacological effect does not persist after discontinuation. SURMOUNT-5 (Aronne et al., NEJM 2024) reported a 6.5 percentage-point difference in mean weight loss versus semaglutide 2.4 mg (20.2% vs 13.7%) in adults with obesity at 72 weeks. SURPASS-2 (Frías et al., NEJM 2021) reported HbA1c reductions of 2.01–2.30 percentage points versus 1.86 percentage points for semaglutide 1 mg over 40 weeks in adults with type 2 diabetes. SURPASS-CVOT (Lincoff et al., NEJM 2025) established non-inferiority to dulaglutide for three-point MACE in adults with type 2 diabetes and atherosclerotic cardiovascular disease, with an expanded MACE hazard ratio of 0.88 favouring tirzepatide. SUMMIT (Packer et al., NEJM 2024) reported HR 0.62 for cardiovascular death or worsening heart failure versus placebo in adults with HFpEF and obesity (n=731), and a Kansas City Cardiomyopathy Questionnaire clinical summary score improvement of +6.9 points. A body-composition substudy of SURMOUNT-1 found that approximately 25–30% of total weight loss was lean mass without resistance training — a proportion similar to semaglutide. The published evidence base also includes approximately 30 systematic reviews and network meta-analyses pooling tirzepatide data across efficacy, safety, cardiovascular outcomes, and comparative-effectiveness questions. A large share of the clinical evidence is concentrated in Eli Lilly-sponsored trials; independent academic replication exists primarily through those meta-analyses.
- Animal: Comprehensive preclinical program in rodent and primate models established the synergistic weight-loss and glycemic effects of dual GIP/GLP-1 agonism prior to clinical development. Detailed individual animal study results are not extracted from the available sources.
- In vitro: Receptor pharmacology of dual GIP/GLP-1 agonism is well-characterised. The molecule is described in available literature as an imbalanced and biased dual agonist, with greater affinity at the GIP receptor than at the GLP-1 receptor (JCI Insight 2020).
Known effects
- Weight reduction (chronic weight management) — FDA-approved (Zepbound). Mean 15–22.5% body-weight reduction at 72 weeks in Phase III trials across SURMOUNT program. Superiority over semaglutide 2.4 mg confirmed in SURMOUNT-5 head-to-head.
- Glycaemic control (type 2 diabetes) — FDA-approved (Mounjaro). HbA1c reductions of approximately 2.0–2.4 percentage points at maintenance doses across SURPASS trials; best-in-class versus comparators in network meta-analyses.
- Obstructive sleep apnea severity reduction — FDA-approved (Zepbound, December 2024). Apnea-hypopnea index reduction in SURMOUNT-OSA.
- Heart failure outcomes (HFpEF + obesity) — Phase III (SUMMIT). HR 0.62 for cardiovascular death or worsening heart failure; KCCQ-CSS improvement +6.9 points. Single completed trial; broader HFpEF outcome confirmation pending.
- Cardiovascular event reduction (T2D + ASCVD) — Phase III CVOT (SURPASS-CVOT). Non-inferiority to dulaglutide for 3-point MACE; expanded MACE HR 0.88 favoured tirzepatide.
- Blood pressure and lipid reduction — Phase III (across SURPASS and SURMOUNT programs). Tirzepatide was the most effective agent for lowering systolic blood pressure in obesity populations in network meta-analyses.
- Liver fat reduction (MASLD/MASH) — Phase III (SYNERGY-NASH). Superior liver fat reduction and higher MASH resolution rates versus placebo and versus semaglutide in available meta-analyses. Regulatory and labelling implications not yet resolved as of early 2026.
- Diabetes prevention (obesity with prediabetes) — Phase III. Reduction in conversion from prediabetes to type 2 diabetes in adults with obesity; trial completed and published.
- Body composition — lean mass loss — Phase III substudy. Approximately 25–30% of total weight loss is lean mass without resistance training; similar pattern to semaglutide. Not an adverse effect in the regulatory sense, but a clinically relevant composition finding.
Myths and misconceptions
"Tirzepatide is just a stronger version of semaglutide." Tirzepatide has a mechanistically distinct profile: it activates both the GIP receptor and the GLP-1 receptor, while semaglutide activates only GLP-1. The dual agonism is why SURMOUNT-5 showed a 6.5 percentage-point difference in weight loss (20.2% vs 13.7%). "Stronger" captures the clinical outcome but misrepresents the pharmacology — the GIP component produces effects on adipose tissue and energy handling that a selective GLP-1 agonist cannot replicate.
"More weight loss means worse side effects." Head-to-head comparisons and meta-analyses show broadly comparable incidence of gastrointestinal adverse events between tirzepatide and semaglutide. Tirzepatide's superior efficacy does not come at a proportionally higher GI cost, though individual patients may tolerate one molecule better than the other and specific symptom profiles differ (e.g., sulfur eructation reported as more prominent with tirzepatide).
"Compounded tirzepatide from online pharmacies is the same drug as Zepbound." Compounded tirzepatide is not FDA-approved, is not bioequivalence-tested, and its active pharmaceutical ingredient may include salt forms or impurities not present in branded Mounjaro or Zepbound. With the FDA declaring the branded shortage resolved in October 2024, much ongoing compounding falls outside the narrow legal 503A pathway.
"Once you reach your goal weight on tirzepatide you can stop and keep the results." SURMOUNT-4 directly tested this: participants who stopped after 36 weeks of titration regained approximately 14 percentage points of body weight over the following 52 weeks, while those who continued tirzepatide lost additional weight. The pharmacological effect does not persist after discontinuation.
Safety signals
Gastrointestinal adverse events are the dominant tolerability signal across Phase III trials. The four-week dose-escalation cadence is designed to improve GI tolerability; symptoms typically concentrate in the first week after each dose increase and attenuate thereafter.
| Signal | Evidence context | Notes |
|---|---|---|
| Nausea | FDA label and Phase III trials | Most common adverse event; dose-dependent |
| Diarrhea | FDA label and Phase III trials | Common; broadly comparable to semaglutide in head-to-head comparisons |
| Vomiting | FDA label and Phase III trials | Common; concentrates around dose escalations |
| Constipation | FDA label and Phase III trials | Common |
| Sulfur eructation ("sulfur burps") | Phase III trials and post-marketing reports | Reported as more pronounced than with semaglutide; typically improves with titration |
| Injection-site reactions | Phase III trials and post-marketing | Generally mild; rotation of injection sites recommended |
| Pancreatitis | Class-level signal in FDA label | Carried in tirzepatide label; post-marketing surveillance ongoing |
| Gallbladder events (cholelithiasis, cholecystitis) | Phase III trials and meta-analyses | Class-level signal; characterised in a specific tirzepatide safety meta-analysis |
| Medullary thyroid C-cell tumour | Boxed warning shared across the incretin class | Based on rodent C-cell tumour findings; no confirmed human signal established |
| Lean mass loss (~25–30% of weight lost) | DEXA data, SURMOUNT-1 body-composition substudy | Similar pattern to semaglutide; role of resistance training not characterised in trials |
| Long-term safety (>2–3 years) | Phase III extension data | Published continuous exposure capped at approximately 88 weeks; chronic-use surveillance beyond this window not yet available |
Label safety exclusions per FDA label: Personal or family history of medullary thyroid carcinoma; Multiple Endocrine Neoplasia syndrome type 2; prior serious hypersensitivity reaction to tirzepatide or formulation components; active or recurrent pancreatitis (label caution); pregnancy (animal reproductive toxicity data; label advises discontinuation before planned conception); breastfeeding (transfer into human milk not adequately characterised); severe gastroparesis or significant gastrointestinal motility disorders; use under age 18 (not approved in paediatric populations as of early 2026).
Regulatory status
| Region / body | Status | Notes |
|---|---|---|
| US — FDA (Mounjaro) | Approved May 2022 | Adults with type 2 diabetes |
| US — FDA (Zepbound) | Approved November 2023 | Adults with obesity, or overweight with at least one weight-related comorbidity |
| US — FDA (Zepbound) | Approved December 2024 | Moderate-to-severe obstructive sleep apnea in adults with obesity |
| US — FDA (Zepbound KwikPen) | Approved February 2026 | Multi-dose autoinjector pen format |
| US — FDA (compounding) | Shortage resolved October 2024 | Most 503A compounding substantially restricted by subsequent FDA enforcement and litigation; state-level clinical compounding under personalised-prescription carve-outs continues in some jurisdictions and remains legally unsettled as of early 2026 |
| US — Medicare Part D | Coverage expanding April 2026 | Lilly–US Government BALANCE agreement (announced November 2025); Medicare Part D copay capped at $50/month for Zepbound starting April 2026 |
| US — generics | None | Patent protection runs into the 2030s |
| EU — EMA | Approved (Mounjaro, 2022) | Separate authorisation for obesity indication |
| UK — MHRA | Approved | NHS obesity access restricted by NICE criteria |
| Canada — Health Canada | Approved | Parallel indications |
| Australia — TGA | Approved | Parallel indications |
| WADA | Not currently listed by name on the WADA Prohibited List | WADA has signalled rising scrutiny of GLP-1/GIP agonists in weight-category and endurance sports; athletes subject to anti-doping regulation should verify current status before use |
Mechanism
Tirzepatide is a 39-amino-acid synthetic peptide that simultaneously activates the GIP receptor (GIPR) and the GLP-1 receptor (GLP-1R). Available literature consistently identifies GIPR as the primary differentiator from semaglutide, while the dual mechanism produces synergistic rather than merely additive metabolic effects (JCI Insight, 2020).
GLP-1 receptor activation reproduces the established class effects: slowed gastric emptying, enhanced meal-stimulated insulin secretion, suppressed glucagon, and engagement of central satiety pathways via hypothalamic and brainstem circuits. GIP receptor activation contributes additional mechanisms in adipose tissue (improved insulin sensitivity and altered lipid handling), in pancreatic beta cells (potentially enhanced beta-cell function and preserved insulin secretory capacity), and in central appetite and food-preference circuits. A distinct effect on food preference — particularly diminished appetite for high-fat and high-palatability foods — is reported more prominently for tirzepatide than for selective GLP-1 agonists and is attributed to the GIP component.
The molecule has greater affinity at the GIP receptor than at the GLP-1 receptor and is described in the pharmacological literature as an imbalanced and biased dual agonist (JCI Insight 2020). The C-20 fatty diacid modification on the backbone enables albumin binding, providing the approximately 5-day half-life and once-weekly subcutaneous dosing — a half-life consistent across available literature including the management review in Diabetologia (2022).
The synergy of dual agonism is the proposed basis for the larger clinical effect size. SURMOUNT-5 demonstrated a 6.5 percentage-point difference in mean weight loss versus semaglutide 2.4 mg at 72 weeks; the SURPASS program showed best-in-class HbA1c reductions among approved agents in adults with type 2 diabetes (mean difference approximately −2.10 percentage points vs placebo, 95% CI −2.47 to −1.74 in one network meta-analysis). The mechanistic contributions of GIPR agonism to adipose-tissue insulin sensitivity and beta-cell function in humans are supported by dual incretin biology; their direct quantitative contribution to clinical outcomes has not been disentangled in published trials.
Open questions
- Long-term outcomes (>2–3 years). Published continuous Phase III exposure data are capped at approximately 88 weeks (SURMOUNT-1 extension and SURMOUNT-4). Five-year-plus data on sustained weight maintenance, cardiovascular events, and durability of HbA1c effect are not yet published.
- Paediatric efficacy and safety. Not approved in patients under 18. Adolescent trials are early-stage relative to the liraglutide and semaglutide adolescent programs; no paediatric efficacy or safety data are available in the published literature.
- Comparative effectiveness vs next-generation polyagonists. Direct head-to-head data against retatrutide (triple GLP-1/GIP/glucagon agonist) and other emerging candidates are not yet published. Whether tirzepatide's efficacy ceiling is matched or exceeded is an open question.
- Body composition optimisation. Approximately 25–30% of total weight loss is lean mass without resistance training (similar to semaglutide). Whether structured resistance training, dietary protein optimisation, or specific co-interventions reduce the lean-mass fraction of weight loss is not characterised in available trials.
- MASH and label-expansion lanes. SYNERGY-NASH showed superior liver fat reduction in MASLD. Final regulatory and labelling implications, and broader cardiovascular/MASH outcome integration, are not yet resolved as of early 2026.
- Cardiovascular outcomes outside SURPASS-CVOT and SUMMIT. Agent-level cardiovascular benefit is established in adults with type 2 diabetes and ASCVD, and in HFpEF with obesity. Broader long-term cardiovascular outcomes in primary-prevention obesity populations without diabetes or HFpEF are still accumulating.
Related peptides
- Semaglutide — GLP-1 receptor agonist (Ozempic/Wegovy/Rybelsus); the most direct predecessor and the active comparator in SURMOUNT-5 and SURPASS-2. Tirzepatide's dual GIP/GLP-1 mechanism consistently shows larger weight reduction versus semaglutide 2.4 mg in head-to-head data.
- Retatrutide — triple GLP-1/GIP/glucagon receptor agonist currently in Phase III; the next-generation candidate against which tirzepatide's efficacy ceiling will eventually be measured. No card yet.
- Liraglutide — daily GLP-1 receptor agonist (Victoza/Saxenda); the first-generation incretin in the same therapeutic space; now largely superseded by semaglutide and tirzepatide in terms of clinical adoption. No card yet.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could Tirzepatide work better than older drugs because it triggers a different kind of cellular signal, not just because it hits two receptors?
If true, this insight could help chemists design future drugs that produce more weight loss with fewer side effects, and help doctors predict which patients will respond best.
Does activating the GIP receptor on fat cells help the body burn stored fat, separate from making people feel full?
If true, this would explain why Tirzepatide causes more weight loss than older drugs and could help scientists design even better treatments that target fat tissue directly, benefiting people who struggle to lose weight through appetite control alone.
Could Tirzepatide, already approved for diabetes and obesity, also slow the brain-cell damage that causes Parkinson's disease?
If true, millions of Parkinson's patients, who currently have no drugs that stop disease progression, might benefit from a treatment already known to be safe in humans, potentially reaching patients much faster than a brand-new drug.
Could engineering the non-functional end of Tirzepatide to form a slow-release depot under the skin replace the need for weekly injections?
If true, people managing diabetes or obesity could switch from weekly injections to monthly ones, making the treatment far easier to stick with and potentially opening the door to new patients who struggle with frequent dosing.
Could activating two gut hormone receptors at once help the remaining intestine grow and work better after large portions are surgically removed?
If true, people with short bowel syndrome, who must receive nutrition through IV lines for life, could potentially eat normally or reduce their dependence on intravenous feeding, dramatically improving their daily lives.
Could the apparently purposeless floppy end of the drug molecule be what allows it to hit two different receptors at once?
If true, drug designers could engineer the next generation of weight-loss drugs by tweaking this tail to precisely dial up or down each receptor, potentially reducing side effects or improving weight loss for specific patient groups.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7772039175033569 | openfold3-mlx |
| ranking score | 0.8402016162872314 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.697 | global PDE — lower = better |
| disorder | 0.141 | fraction disordered |
| chain pair ipTM (A, B) | 0.777 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| runtime | 445s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-14 |
▸citationbibtex
@peptide{pep00017,
sequence = {YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS},
target = {gipr},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}