Lixisenatide: Adlyxin/Lyxumia type 2 diabetes drug
A once-daily injectable drug that helps control blood sugar in type 2 diabetes by mimicking a natural gut hormone; FDA-approved drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Lixisenatide (brand name Adlyxin in the US, Lyxumia in Europe) is a 44-amino acid once-daily injectable GLP-1 receptor agonist. It is derived from exendin-4, a peptide originally isolated from the saliva of the Gila monster lizard (Heloderma suspectum), and was FDA-approved in July 2016 for type 2 diabetes. Relative to other GLP-1 receptor agonists, lixisenatide is notable for particularly strong effects on postprandial (after-meal) glucose via gastric emptying delay, and for a neutral — rather than beneficial — result in its cardiovascular outcomes trial. More recently, it has attracted significant attention outside diabetes: the LIXIPARK Phase 2 trial published in NEJM in 2024 (Meissner et al.) reported that lixisenatide slowed motor decline in early Parkinson's disease, making it one of the most-discussed GLP-1 repurposing candidates in neurology. The stored sequence is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK (44 aa); the C-terminal hexalysine tail (KKKKKK) distinguishes it from the parent exendin-4 sequence and is key to its pharmacological profile — it is absent from some representations of the exendin-4 backbone.
History
Exendin-4, the Gila monster salivary peptide, was identified in the early 1990s as a potent GLP-1 receptor agonist. Lixisenatide was developed by Zealand Pharma and licensed to Sanofi as a modified exendin-4 analog: Pro38 from the native exendin-4 sequence was removed and six lysine residues were appended to the C-terminus, improving receptor binding and resistance to degradation by the enzyme DPP-4. Lixisenatide received EMA approval in February 2013 (Lyxumia) and FDA approval in July 2016 (Adlyxin). Sanofi discontinued US marketing of the standalone Adlyxin product in 2023 for commercial reasons — not due to safety concerns — as once-weekly alternatives had largely displaced once-daily short-acting agents. Lixisenatide continues to be marketed outside the US as Lyxumia, and in both the US and EU as Soliqua (a fixed-ratio combination with insulin glargine 100 U/mL). The 2024 LIXIPARK Phase 2 results (Meissner et al., NEJM) renewed interest in lixisenatide, this time for Parkinson's disease.
What it does
Lixisenatide activates the GLP-1 receptor in the pancreas, driving glucose-dependent insulin release and glucagon suppression, and in the gastrointestinal tract, producing a pronounced delay in gastric emptying. That gastric effect is the defining pharmacological feature of short-acting GLP-1 agonists: lixisenatide flattens the spike in blood glucose that follows meals more effectively than longer-acting agents, while producing less CNS-mediated appetite suppression and less fasting glucose reduction than once-weekly agents such as semaglutide or dulaglutide (Htike et al. 2017; Broglio et al. 2017). Weight loss is modest compared to longer-acting class members. For Parkinson's disease, the same GLP-1 receptors expressed on dopaminergic neurons in the brain appear to be relevant: preclinical models show GLP-1R activation reduces alpha-synuclein pathology and neuroinflammation, and the LIXIPARK trial provided the first controlled human evidence that this translates to slowed motor decline (Meissner et al. 2024; Sun et al. 2026).
Evidence
- Human: The GetGoal Phase 3 program — approximately 12 pivotal trials across diverse patient populations — demonstrated that lixisenatide 20 µg once daily reduced HbA1c by roughly 0.7–1.0% and produced pronounced reductions in 2-hour postprandial glucose, consistent with its gastric-dominant mechanism (Broglio et al. 2017; Blonde et al. 2017; Bonadonna et al. 2017). The ELIXA cardiovascular outcomes trial (Pfeffer et al. 2015, NEJM) enrolled 6,068 patients with type 2 diabetes and recent acute coronary syndrome and found no significant difference in MACE versus placebo — a neutral result, in contrast to the cardiovascular benefit seen with liraglutide (LEADER) and semaglutide (SUSTAIN-6). An exploratory ELIXA analysis found no worsening of renal outcomes (Muskiet et al. 2018). In Parkinson's disease, LIXIPARK (Meissner et al. 2024, NEJM) was a Phase 2 randomized trial (n=156) in early Parkinson's disease: at 12 months, the lixisenatide group showed essentially no change in motor function (MDS-UPDRS Part III), while the placebo group declined by 3.04 points — a statistically significant difference, though the trial was not powered for Phase 3 confirmation. Multiple commentaries noted this as a striking but preliminary signal (Friedman 2024; Irfan et al. 2024; Doggrell 2025). Phase 3 is pending.
- Animal: Preclinical GLP-1R agonist studies in MPTP and alpha-synuclein models of Parkinson's disease show neuroprotection, and recent work in a mouse model directly showed lixisenatide reduced propagation of alpha-synuclein pathology (Sun et al. 2026). Exendin-4 (the parent peptide) showed protective effects in multiple rodent neurodegeneration models, providing preclinical rationale for the LIXIPARK trial design.
- In vitro: Lixisenatide binds GLP-1R with high affinity; as a short-acting agonist it dissociates more rapidly than semaglutide, producing a pulsatile receptor activation profile. A meta-analysis by Ahrén and colleagues (2014) documented the pronounced postprandial glucagon suppression characteristic of lixisenatide across randomized trials.
Myths and misconceptions
"All GLP-1 receptor agonists have the same cardiovascular benefit." ELIXA (Pfeffer et al. 2015) showed neutral cardiovascular outcomes with lixisenatide. The benefit seen with liraglutide (LEADER) and semaglutide (SUSTAIN-6) is not a universal GLP-1 RA class effect, and the mechanistic explanation for the difference remains unresolved.
"Lixisenatide was discontinued because of safety problems." Sanofi withdrew the standalone Adlyxin product from the US market in 2023 for commercial reasons. Lixisenatide remains FDA- and EMA-approved as Soliqua (in combination with insulin glargine), and standalone Lyxumia remains marketed in other regions.
Common questions
Is lixisenatide still available? Yes — as Soliqua (insulin glargine/lixisenatide fixed-ratio combination) in the US and EU, and as standalone Lyxumia in many non-US markets. The standalone Adlyxin injection was discontinued in the US by Sanofi in 2023 for commercial reasons.
What did the LIXIPARK trial show? The LIXIPARK Phase 2 trial (Meissner et al. 2024, NEJM) randomized 156 patients with early Parkinson's disease to daily lixisenatide or placebo for 12 months. The lixisenatide group showed no significant motor decline on MDS-UPDRS Part III at 12 months, while the placebo group declined by a mean of 3.04 points. This was statistically significant, though the trial was small and Phase 3 confirmation is still pending (Doggrell 2025).
How does lixisenatide compare to semaglutide or tirzepatide? Lixisenatide is a once-daily short-acting agent with strong postprandial glucose effects but modest weight loss (~1–2 kg) and a neutral cardiovascular profile. Semaglutide and tirzepatide are once-weekly long-acting agents with substantially greater HbA1c and weight reduction and demonstrated cardiovascular benefit in their trials. The comparison is primarily relevant for patients whose main need is postprandial control combined with basal insulin (Soliqua's niche), or in the Parkinson's research context.
Known effects
- HbA1c reduction approximately 0.7–1.0% in Phase 3 trials (GetGoal program; Broglio et al. 2017)
- Pronounced postprandial glucose lowering via gastric emptying delay (Ahrén et al. 2014)
- Modest weight loss (~1–2 kg) — less than longer-acting agents (Htike et al. 2017)
- Neutral cardiovascular outcomes — no MACE benefit or harm (ELIXA; Pfeffer et al. 2015)
- Slowed motor decline in early Parkinson's disease — Phase 2 signal (LIXIPARK; Meissner et al. 2024) — Emerging
- Nausea and vomiting, especially at treatment initiation (class effect)
- Injection site reactions
Safety signals
GI adverse effects — nausea, vomiting, and diarrhea — are frequent at treatment initiation, as with the GLP-1 RA class broadly. The ELIXA trial (n=6,068; Pfeffer et al. 2015) found no increased risk of pancreatitis or other major safety signals versus placebo. Hypoglycemia risk is low without concomitant insulin or sulfonylurea; it is present when lixisenatide is combined with either. The standard GLP-1 RA class boxed warning for medullary thyroid carcinoma and MEN-2 applies, based on rat carcinogenicity data with no established human signal. Post hoc analysis of renal outcomes in ELIXA found no worsening of renal function (Muskiet et al. 2018). Efficacy over time in some patients may be limited by anti-drug antibody formation (McCarty et al. 2017).
Regulatory status
- US: FDA-approved July 2016 (Adlyxin). Standalone Adlyxin withdrawn from US market by Sanofi in 2023 for commercial reasons. Soliqua (insulin glargine 100 U/mL / lixisenatide 33 µg/mL) remains FDA-approved. Not approved for obesity or Parkinson's disease.
- EU: EMA-approved February 2013 (Lyxumia). Soliqua also EMA-approved. Available as standalone Lyxumia in many markets outside the US.
- WADA: Not on the prohibited list (not a peptide hormone or growth factor).
Related peptides
- Exenatide — the direct predecessor; same exendin-4 backbone without the C-terminal hexalysine modification; twice-daily (Byetta) and once-weekly (Bydureon) formulations; see /card/pep-04439
- Semaglutide (Ozempic/Wegovy) — once-weekly GLP-1 RA with substantially greater HbA1c reduction, weight loss, and positive cardiovascular outcomes; the dominant long-acting comparator
- Liraglutide (Victoza/Saxenda) — once-daily long-acting GLP-1 RA with positive cardiovascular outcomes (LEADER trial); contrasts with lixisenatide's neutral ELIXA result; see /card/pep-10868
Mechanism
Lixisenatide is a high-affinity agonist at the GLP-1 receptor (GLP-1R), a class B GPCR. Receptor activation drives Gαs/cAMP/PKA signaling in pancreatic beta cells (glucose-dependent insulin secretion) and alpha cells (glucagon suppression), and activates GLP-1R on vagal efferents and enteric neurons in the pylorus and antrum, slowing gastric emptying and blunting postprandial glucose absorption. The C-terminal hexalysine extension (KKKKKK) — absent from the native exendin-4 sequence — sterically hinders DPP-4 access to the N-terminal cleavage site, extending plasma half-life to approximately 2.7–4.3 hours versus approximately 2 minutes for native GLP-1 (McCarty et al. 2017). This short half-life produces a pulsatile pharmacological profile: each injection generates a concentration peak that, when timed before a meal, maximally engages GLP-1R in GI motility circuitry. Long-acting agents become tachyphylactic to gastric effects; lixisenatide does not, which explains its gastric-dominant pharmacology. In the brain, GLP-1R is expressed on dopaminergic neurons in the substantia nigra. Preclinical evidence shows GLP-1R activation reduces alpha-synuclein aggregation, neuroinflammation, and oxidative stress (Sun et al. 2026). The LIXIPARK trial hypothesis was that this pathway translates to slowed neurodegeneration in Parkinson's disease — a mechanistically plausible but still-emerging picture whose Phase 3 validation is pending.
Open questions
- Whether lixisenatide's cardiovascular neutrality in ELIXA reflects a short-acting GLP-1 RA class limitation, the specific post-ACS population enrolled, or insufficient drug exposure duration is unresolved
- Whether a Phase 3 Parkinson's trial will confirm the LIXIPARK Phase 2 motor-decline signal, and whether non-motor symptoms or biomarkers of neurodegeneration will also respond (Doggrell 2025)
- Whether the short-acting gastric-dominant pharmacology offers specific advantages in populations with high postprandial glucose excursions (post-bariatric patients, reactive hypoglycemia, insulin-treated patients) compared to long-acting agents
- Optimal duration and patient selection criteria for lixisenatide in a potential Parkinson's indication remain undefined
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Can lixisenatide's strong ability to slow stomach emptying prevent the dangerous blood sugar drops that affect many patients after weight-loss surgery?
If effective, lixisenatide could become the first approved treatment for a serious post-bariatric surgery complication affecting hundreds of thousands of patients worldwide, preventing hospitalizations and improving quality of life.
Does lixisenatide slow Parkinson's by acting directly on neurons in the brain, rather than by improving blood sugar control?
If confirmed, this would establish lixisenatide as one of the first drugs to directly protect the dying brain cells in Parkinson's disease, potentially slowing or halting progression for millions of patients worldwide.
Does a GLP-1 drug need to stay active in the body all day and night to protect the heart, which would explain why short-acting lixisenatide offers no heart benefit?
If true, doctors would have a clearer scientific basis for choosing long-acting GLP-1 drugs over short-acting ones specifically when heart protection is needed, personalizing treatment for millions of type 2 diabetes patients at cardiovascular risk.
Does the distinctive tail of six positively charged amino acids at the end of lixisenatide help it stay attached to its receptor longer by grabbing onto a negatively charged region?
Understanding this grip mechanism could guide the design of future diabetes and Parkinson's drugs that stay active longer in the body without the need for fatty acid modifications, potentially simplifying drug manufacturing.
Does lixisenatide activate a different signaling pathway inside its receptor compared to related drugs, which would explain why it slows digestion so strongly but has a neutral effect on heart disease?
If true, this explains why lixisenatide works differently from drugs like semaglutide, and could guide the development of the next generation of GLP-1 drugs tailored for specific benefits, such as better postprandial control or improved gut motility in patients with gastroparesis.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7532619833946228 | openfold3-mlx |
| ranking score | 0.8350138664245605 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.712 | global PDE — lower = better |
| disorder | 0.170 | fraction disordered |
| chain pair ipTM (A, B) | 0.753 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | — |
| hardware | — |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | — |
| diffusion samples | 1 |
| runtime | 553s |
| predicted by | mlx@peptide |
| predicted at | 2026-05-03 |
▸citationbibtex
@peptide{pep10891,
sequence = {HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}