pe
pep-00018 v1 CC-BY-SA-4.0

Retatrutide: LY3437943, triple-action weight-loss drug (GIP/GLP-1/glucagon)

An experimental once-weekly injection that activates three hunger-and-metabolism hormones at once, producing 23.7% weight loss in late-stage trials; not yet an FDA-approved drug.

statusbioassayed targetGCGR length40 aa refs5
glp-1gipglucagontriple-agonistobesityfda-not-approvedreference-scaffold
snapshot clinical 60% confidence
Class
Triple GIP / GLP-1 / glucagon receptor agonist (investigational)
Status
Investigational drug; not FDA-, EMA-, MHRA-, Health Canada-, or TGA-approved as of the source date (April 2026). In Phase 3 development under Eli Lilly's TRIUMPH program.
Best-supported effect
Substantial body-weight reduction in adults with obesity at the 12 mg weekly subcutaneous dose, established in a Phase 2 trial (24.2% at 48 weeks) and reported again in the Phase 3 TRIUMPH-4 readout.
Main caveat
Most of the Phase 3 program is still reading out, long-term safety beyond ~88 weeks is uncharacterized, and the entire human evidence package comes from a single sponsor (Eli Lilly) with no completed independent replication.
status 4 / 5 · 2 verified on platform
prediction metrics openfold3-mlx 0.3.1
ipTM0.762
pTM0.744
avg pLDDT58.2
ranking score0.831
STRUCTURE · PEP-00018 × GCGR
ranking0.831
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence40 aa
1510152025303540
YAEGTFISDYSIAMDEIHQQ DFVNWLLAQKGKKNDWKHNI
in the news 265 articles
overview readme

What this is

Retatrutide (Eli Lilly code LY3437943) is an investigational once-weekly injectable peptide designed to activate three hormone receptors at the same time — the GLP-1 receptor, the GIP receptor, and the glucagon receptor. That triple combination sets it apart from earlier drugs in the same class: semaglutide targets only GLP-1, while tirzepatide (/card/pep-00017) targets GLP-1 and GIP. Adding the glucagon receptor introduces a distinct mechanism — increased energy expenditure and hepatic fat mobilisation — that neither single nor dual incretin agonists provide alone. Lilly describes it as a 39-residue peptide built on a modified GIP backbone; the raw stored sequence does not reflect a fatty-acid conjugation that accounts for the roughly six-day plasma half-life enabling once-weekly dosing (Jastreboff and colleagues, NEJM 2023). As of the available literature date (April 2026), retatrutide is not approved in any major jurisdiction; clinical exposure occurs only inside Lilly's Phase 3 TRIUMPH program.

History

Retatrutide's scientific premise built on tirzepatide's Phase 3 success and on decades of evidence that glucagon-receptor agonism increases energy expenditure and mobilises hepatic fat — an attractive therapeutic target that had been difficult to use in isolation because glucagon also raises blood glucose. The solution Lilly pursued was to pair glucagon-receptor activity with strong GLP-1 and GIP co-agonism, using the glucose-lowering effects of the incretin arms to neutralise the hyperglycaemic risk of the glucagon arm. The molecular design and first proof-of-concept data were published in 2022 (Coskun and colleagues described LY3437943 discovery through clinical proof of concept in Cell Metabolism that year). The landmark Phase 2 obesity trial published in NEJM (Jastreboff and colleagues, 2023) reported 24.2% mean body-weight reduction at 48 weeks at the 12 mg dose — the largest obesity-drug weight loss published at that time. A companion Phase 2 trial in type 2 diabetes (Rosenstock and colleagues, Lancet 2023) and a Phase 2a trial in metabolic dysfunction-associated steatotic liver disease (Sanyal and colleagues, Nature Medicine 2024) followed. Phase 3 development — the TRIUMPH program — began enrolling in 2022 across at least eight trials covering obesity, type 2 diabetes, MASH, obstructive sleep apnea, hypertension, and cardiovascular outcomes. TRIUMPH-4, a Phase 3 trial in adults with obesity and knee osteoarthritis (n=445), reported positive topline results in December 2025, with 23.7% mean weight loss at 12 mg at 68 weeks; a Phase 3 type 2 diabetes trial (TRANSCEND-T2D-1, n=537) reported positive topline results in March 2026. Most of the TRIUMPH program had not yet read out at the published literature date.

What it does

Retatrutide acts at three hormone receptors, each contributing a distinct metabolic effect. GLP-1 receptor activation reduces appetite by signalling satiety through hypothalamic and brainstem circuits and slows gastric emptying — the same mechanism shared with semaglutide (/card/pep-00016) and tirzepatide. GIP receptor activation adds complementary appetite suppression and improves insulin sensitivity. Glucagon receptor activation is the novel addition: it increases resting energy expenditure, drives lipolysis, and accelerates hepatic fatty-acid oxidation, thereby reducing liver fat — effects that the incretin arms alone do not produce. Together, the three pathways produce body-weight reductions in clinical trials that exceed what has been observed with approved single or dual incretin agents. In the Phase 2 MASH trial, the glucagon component is the proposed explanation for unusually large liver-fat reductions (Sanyal and colleagues, Nature Medicine 2024). The trade-off is that glucagon-receptor activation also produces a resting heart-rate elevation and, at higher doses, modest transient increases in fasting glucose that dual or single incretin agonists do not share.

Evidence

  • Human: Strong Phase 2 evidence across three indications. Jastreboff and colleagues (NEJM 2023) reported 24.2% mean body-weight loss at 48 weeks in adults with obesity (n=338, Phase 2; 12 mg dose). Rosenstock and colleagues (Lancet 2023) reported HbA1c reductions up to 2.02 percentage points at 36 weeks in adults with type 2 diabetes (Phase 2). Sanyal and colleagues (Nature Medicine 2024) reported more than 80% relative liver-fat reduction at 48 weeks in adults with metabolic dysfunction-associated steatotic liver disease (Phase 2a). Phase 3 TRIUMPH-4 (obesity with knee osteoarthritis; December 2025 topline) reported 23.7% mean weight loss at 12 mg at 68 weeks and a WOMAC pain reduction of 75.8%; Phase 3 TRANSCEND-T2D-1 (type 2 diabetes; March 2026 topline) reported positive results. All human evidence originates with a single sponsor; no independent replication is in the available literature.
  • Animal: The triple-agonism concept is described as well-supported in preclinical models; a comparative study in db/db mice examined effects on diabetic kidney disease relative to liraglutide and tirzepatide.
  • In vitro: Receptor-level pharmacology of GIPR, GLP-1R, and GCGR activation is established through the broader incretin literature; assay-level data are not separately extracted in this card.

Known effects

  • Body-weight reduction (obesity) — Phase 2 (NEJM 2023): 24.2% at 48 weeks, 12 mg; Phase 3 TRIUMPH-4 topline: 23.7% at 68 weeks, 12 mg. Curve was still descending at Phase 2 trial end, suggesting a higher plateau with longer treatment.
  • HbA1c reduction (type 2 diabetes) — Phase 2 (Lancet 2023): up to 2.02 percentage points at 36 weeks, 12 mg.
  • Liver-fat reduction (MASH/MASLD) — Phase 2a (Nature Medicine 2024): >80% relative reduction at 24–48 weeks, 12 mg. Substantial histologic resolution also reported in that trial.
  • Knee osteoarthritis pain reduction — Phase 3 TRIUMPH-4 topline: WOMAC pain score reduced 75.8% at 68 weeks alongside the weight-loss endpoint.
  • Resting energy expenditure increase — Attributed to glucagon-receptor agonism; quantified in trial pharmacology data but not separately extracted here.
  • Heart-rate elevation — Phase 2 trials: mean +2 to +6 bpm at 12 mg; attributed to glucagon-receptor activation; under continued monitoring in Phase 3.

Safety signals

Gastrointestinal events — nausea, vomiting, diarrhea, constipation, and decreased appetite — were reported in Phase 2 and Phase 3 trials at rates described as broadly comparable to tirzepatide and concentrated at dose-escalation steps (Jastreboff and colleagues, NEJM 2023; Rosenstock and colleagues, Lancet 2023). Treatment discontinuation reached approximately 18% at the 12 mg dose in the Phase 2 obesity trial, described in available literature as higher than rates reported with semaglutide and tirzepatide at their respective top doses.

A signal not seen with other incretin drugs is dysesthesia — tingling, burning, or pin-and-needle sensations in the extremities — with an approximately 21% incidence at 12 mg in the Phase 2 obesity trial. Severity was described as variable and usually transient; the mechanism is uncharacterised in the available literature.

Heart-rate elevation of approximately +2 to +6 bpm at 12 mg is attributed to glucagon-receptor activation and is under continued Phase 3 monitoring. Modest fasting-glucose and HbA1c excursions at higher doses were reported in Phase 2 and attributed to the glucagon component.

For pancreatitis, thyroid neoplasia, and liver injury, available sources report no signal in published retatrutide trials. The class-level concerns from GLP-1 and incretin agonists — including the boxed-warning parallel for medullary thyroid carcinoma and Multiple Endocrine Neoplasia syndrome type 2 — are expected to apply to retatrutide based on shared rodent C-cell tumour findings in the class. Long-term safety beyond approximately 88 weeks is uncharacterised; dedicated Phase 3 cardiovascular outcome data had not read out at the available literature date.

Drug-interaction observations available in published literature are mechanism-inferred parallels to tirzepatide; no dedicated pharmacokinetic interaction studies are extracted.

Regulatory status

  • US (FDA): Not approved. Investigational drug under Eli Lilly's IND, available only through TRIUMPH-program trial participation. No legal US compounding pathway exists: 503A compounding requires either an approved reference product or a validated bulk drug substance list entry, neither of which applies to retatrutide. Analyst projections described in available literature anticipate an NDA filing in 2026 with potential approval in late 2026 or 2027; these are not regulatory commitments.
  • EU (EMA), UK (MHRA), Canada (Health Canada), Australia (TGA): Not approved. No major regulator has authorised retatrutide as a medicine per available sources.
  • WADA: Not listed by name on the Prohibited List, but falls within the S0 category covering substances "not currently approved by any governmental regulatory health authority for human therapeutic use." Athletes subject to the WADA code should treat retatrutide as prohibited in and out of competition (per available sources; current list status not independently refreshed in this card).

Mechanism

Retatrutide is a 39-amino-acid peptide engineered for simultaneous agonist activity at the GIP receptor (GIPR), GLP-1 receptor (GLP-1R), and glucagon receptor (GCGR). All three receptors are class B G-protein-coupled receptors that signal through Gαs and the cAMP pathway; their individual pharmacology is well characterised from prior drug development.

GLP-1R agonism suppresses appetite via hypothalamic and brainstem satiety circuits, slows gastric emptying, and stimulates glucose-dependent insulin secretion. GIPR agonism provides complementary appetite suppression and improves insulin sensitivity; this pairing — the same combination present in tirzepatide (/card/pep-00017) — underlies the larger weight-loss magnitudes seen with dual compared with single incretin agonists. The retatrutide-specific addition is GCGR agonism, which drives lipolysis, increases hepatic fatty-acid oxidation, increases thermogenesis, and raises resting energy expenditure. In the context of simultaneous GLP-1R and GIPR activation, the hyperglycaemic effect ordinarily produced by isolated glucagon-receptor activation appears neutralised at studied doses, enabling the thermogenic and lipolytic benefits to be harnessed without net glycaemic destabilisation.

The glucagon-receptor arm is the proposed explanation for both retatrutide's incremental weight-loss magnitude beyond tirzepatide and the scale of liver-fat reduction in MASH trials (Sanyal and colleagues, Nature Medicine 2024). The glucagon arm is also the probable source of the drug's distinct safety signals: the approximately +2 to +6 bpm resting heart-rate elevation and the dysesthesia not shared with semaglutide or tirzepatide.

The approximately six-day plasma half-life — supporting once-weekly subcutaneous injection — is consistent with a fatty-acid conjugation enabling albumin binding; residue-level sequence detail beyond the backbone is not reported in the available literature.

Open questions

  • Remaining TRIUMPH Phase 3 readouts. Of the eight planned Phase 3 trials, most outcomes — including dedicated cardiovascular, MASH Phase 3, obstructive sleep apnea, and hypertension endpoints — had not read out at the available literature date.
  • TRIUMPH-4 weight-loss discrepancy. Available sources quote both 23.7% and 28.7% mean weight loss at 12 mg for the TRIUMPH-4 readout; the discrepancy is unresolved in the available literature.
  • Long-term safety beyond ~88 weeks. All published and planned trials end at or before that duration; chronic multi-year safety data are absent.
  • Dysesthesia mechanism. The approximately 21% dysesthesia incidence at 12 mg is not seen with other incretin drugs; the underlying mechanism is uncharacterised.
  • Withdrawal and weight-regain kinetics. No Phase 3 discontinuation-arm data comparable to obesity-drug withdrawal studies is attached; regain timing and magnitude are inferred from class behaviour.
  • Body composition at higher doses. Whether the larger absolute weight loss at 12 mg includes disproportionate lean-mass loss relative to tirzepatide or semaglutide remains under study.
  • Head-to-head comparison with tirzepatide. No completed direct trial exists; comparative efficacy and tolerability rest on cross-trial indirect comparisons with their methodological limits.
  • Independent replication. All human evidence in the available literature originates with Eli Lilly; no independent-program human replication is published.

Related peptides

  • Tirzepatide (/card/pep-00017) — Eli Lilly's dual GIP/GLP-1 receptor agonist; the immediate structural predecessor to retatrutide in the same pipeline, FDA-approved for type 2 diabetes (Mounjaro) and obesity (Zepbound).
  • Semaglutide (/card/pep-00016) — Novo Nordisk's GLP-1 receptor agonist; the most widely used comparator in cross-trial efficacy discussions; approved for type 2 diabetes and weight management.
  • Dulaglutide (/card/pep-10881) — Eli Lilly's once-weekly GLP-1 receptor agonist fusion protein; an earlier entry in Lilly's GLP-1-based pipeline, FDA-approved for type 2 diabetes and cardiovascular risk reduction.
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could this drug fix a dangerous liver condition even in people who barely lose weight on it?

Millions with fatty liver disease (MASH) fail to lose enough weight for current treatments to help them. If this hypothesis holds, retatrutide could treat their liver directly by triggering a fat-burning process called ketogenesis, meaning patients who do not slim down much might still see their liver recover.

The hypothesis
Retatrutide's liver-fat reduction in MASH is mechanistically driven by GCGR-stimulated hepatic ketogenesis (via beta-hydroxybutyrate elevation) rather than by weight loss or incretin signalling alone, making it effective in MASH patients who do not achieve large body-weight reductions.
Why it’s plausible
The MASH Phase 2a trial showed >80% relative liver-fat reduction. The evidence bundle notes that beta-hydroxybutyrate increases were apparent by week 24 and were significantly correlated with liver-fat reduction, and that the dual GLP-1/GCGR agonist efinopegdutide showed greater liver-fat lowering than semaglutide for the same degree of weight loss. A selective GCGR agonist comparison is also referenced. Together these data point to a weight-independent, GCGR-ketogenesis axis as the key liver-fat driver.
Why it matters
If GCGR-mediated ketogenesis drives liver benefit independently of weight loss, retatrutide (or a GCGR-containing analog) would retain MASH efficacy in patients with limited weight-loss response, distinguishing it from pure incretin agents and supporting a separate MASH indication with a different patient-selection strategy.
Plausibility.78
Novelty.35
Impact.73
Basis · grounding2 papers · 1 computed/note
[1]
paper
Beta-hydroxybutyrate increases were apparent by week 24 when most liver-fat reduction had occurred; percent changes in beta-hydroxybutyrate and liver fat were significantly correlated.
doi: 10.1038/s41591-024-03018-2
[2]
paper
Efinopegdutide (dual GLP-1/GCGR agonist) showed greater liver-fat lowering than semaglutide for the same degree of weight loss, and a selective GCGR agonist is noted as relevant comparison.
doi: 10.1038/s41591-024-03018-2
[3]
noteGlucagon arm drives lipolysis and accelerates hepatic fatty-acid oxidation; >80% relative liver-fat reduction at 24-48 weeks in MASH Phase 2a.
openupdated 2026-06-05

Why do some patients on the highest dose feel tingling or burning sensations, and is it a warning for the whole drug class?

About one in five patients at the top dose reported strange skin sensations not seen with similar drugs. If this is confirmed to come from the glucagon part of the drug acting on sensory nerves, it could signal a shared risk for any future drug that targets the glucagon receptor, prompting researchers to redesign that component before it reaches more patients.

The hypothesis
The unexplained dysesthesia signal (~21% incidence at 12 mg) is caused by off-target agonism at the glucagon receptor expressed on peripheral sensory neurons, not by a GLP-1R or GIPR mechanism, making it a dose-limiting glucagon-arm side effect.
Why it’s plausible
Dysesthesia was not reported with semaglutide (GLP-1R only) or tirzepatide (GLP-1R/GIPR dual), so it tracks with the novel glucagon-receptor arm. Glucagon receptors are expressed in peripheral nervous tissue and dorsal root ganglia. The GCGR arm also accounts for the heart-rate elevation, establishing a precedent for autonomic/neural glucagon-receptor effects. The specific tingling/burning pattern is consistent with sensory fiber involvement rather than central or gastrointestinal mechanisms.
Why it matters
If confirmed, GCGR expression in peripheral sensory neurons becomes a liability shared by any future glucagon-containing multi-agonist, and dose-separation strategies (e.g., biased GCGR agonism that retains metabolic signalling but lacks neural activity) would be essential for the class.
Plausibility.43
Novelty.77
Impact.75
Basis · grounding1 paper · 2 computed/notes
[1]
noteDysesthesia reported at ~21% incidence at 12 mg; described as uncharacterised mechanistically; not shared with semaglutide or tirzepatide.
[2]
noteHeart-rate elevation of +2 to +6 bpm at 12 mg is also attributed to GCGR activation, establishing GCGR as the driver of autonomic/neural effects distinguishing retatrutide from dual agonists.
[3]
paper
Retatrutide based on GIP backbone with amino acid substitutions for triple agonism; non-natural amino acids at positions 2, 13, 20 protect from DPP4 cleavage.
doi: 10.1016/j.molmet.2025.102118
openupdated 2026-06-05

Could this drug ease arthritis pain directly in the joint, beyond what losing weight would account for?

Patients in one trial saw their knee pain fall by roughly three-quarters, which looks larger than what weight loss alone typically delivers. If the drug is also calming inflammation inside the joint, it could eventually help people with painful arthritis who are not overweight at all, a much larger group than those currently eligible.

The hypothesis
The knee osteoarthritis pain reduction observed in TRIUMPH-4 (75.8% WOMAC reduction) is driven by anti-inflammatory mechanisms downstream of GLP-1R and/or GIPR signalling in synovial tissue rather than being entirely secondary to mechanical off-loading from weight loss.
Why it’s plausible
TRIUMPH-4 reported 23.7% weight loss alongside 75.8% WOMAC pain reduction. GLP-1 receptors are expressed on immune cells including macrophages and synoviocytes, and GLP-1R agonism suppresses NFkB-mediated inflammatory cytokine production. The magnitude of pain reduction is disproportionate to what is typically observed per unit of weight loss in obesity-associated osteoarthritis trials, suggesting a direct joint anti-inflammatory component. If a weight-independent mechanism exists, lower-weight patients with inflammatory joint disease could benefit.
Why it matters
A direct articular anti-inflammatory effect would open retatrutide (or mono/dual incretin agonists) to osteoarthritis patients who are not obese, broadening the indication considerably beyond metabolic disease.
Plausibility.42
Novelty.55
Impact.58
Basis · grounding2 computed/notes
[1]
noteTRIUMPH-4 Phase 3 (n=445, obesity with knee osteoarthritis): 23.7% mean weight loss and 75.8% WOMAC pain reduction at 68 weeks, 12 mg.
[2]
noteGlucagon, GLP-1, and GIP receptor agonism each contribute distinct metabolic effects; GLP-1R activation has known roles in immune modulation in other contexts.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.761703372001648 openfold3-mlx
ranking score 0.8307342529296875 openfold3-mlx
▸structural qualityopenfold3
metricvaluenote
gpde0.712global PDE — lower = better
disorder0.145fraction disordered
chain pair ipTM (A, B)0.762interface quality
▸3-letter notation
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Glu-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
runtime489s
predicted bymlx@peptide
predicted at2026-04-14
▸citationbibtex
peptidemodel (2026). Retatrutide: LY3437943, triple-action weight-loss drug (GIP/GLP-1/glucagon) (pep-00018, v1). PeptideModel. https://peptidemodel.com/card/pep-00018
@peptide{pep00018,
  sequence = {YAEGTFISDYSIAMDEIHQQDFVNWLLAQKGKKNDWKHNI},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 33 on ct.gov · checked 2026-05-09
ct.gov trials 33
with results 2
PubMed RCT 8
by phase
4phase 12phase 24phase 3
by status
4completed2recruiting4active
references 0 papers · 5 non-peer
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use