Insulin B chain: half of the blood-sugar hormone insulin

What this is

The insulin B chain is one half of insulin — the hormone that controls blood sugar. Insulin is made of two protein chains held together by chemical bonds: the B chain (30 amino acids) and the shorter A chain (21 amino acids, see Insulin A chain). Neither chain works on its own; biological activity requires the complete disulfide-bonded A+B dimer. The three disulfide bonds linking the two chains (A7–B7 and A20–B19 between chains, plus A6–A11 within the A chain) are essential for the three-dimensional shape that lets insulin bind its receptor. The stored sequence FVNQHLCGSHLVEALYLVCGERGFFYTPKT is the canonical human B chain (B1–B30) as first determined by Frederick Sanger (Sanger 1959) — approved recombinant human insulin preparations use this identical B chain, while insulin analogs modify specific residues to alter absorption speed or duration.

History

Insulin was discovered in 1921 by Banting, Best, MacLeod, and Collip at the University of Toronto through the isolation of pancreatic islet extracts that corrected hyperglycemia in depancreatized dogs. The first human patient treated — Leonard Thompson, age 14, in January 1922 — experienced a dramatic metabolic correction within hours of injection, establishing insulin replacement as a life-saving therapy for type 1 diabetes. Banting and MacLeod received the 1923 Nobel Prize in Physiology or Medicine.

The amino acid sequence of the B chain was determined first in Frederick Sanger's decade-long sequencing effort at Cambridge. His method of partial hydrolysis, followed by paper chromatography identification of peptide fragments, established the linear sequence of both chains and the three disulfide bond positions — the first complete primary structure determination of any protein. Sanger received the 1958 Nobel Prize in Chemistry for this work (Sanger 1959). He also noted that bovine, porcine, and human B chain sequences were identical, whereas the A chains differed slightly — establishing that sequence conservation is highest in the receptor-binding-critical regions.

Recombinant human insulin (Humulin, Eli Lilly) became available in 1982 as the first recombinant DNA-derived pharmaceutical protein, produced by expressing separate A and B chains then combining them under oxidizing conditions to form native disulfide bonds. The structural biology advanced through Dorothy Hodgkin's 1969 crystal structure of the insulin hexamer, and culminated after decades of effort in crystal structures of insulin bound to its receptor ectodomain, which revealed the critical conformational change the B chain C-terminus undergoes during receptor engagement (De Meyts 2015).

What it does

The B chain, as part of intact insulin, mediates the primary molecular recognition event at the insulin receptor. Isolated B chain has negligible receptor binding affinity and no glucoregulatory activity — the three-dimensional presentation of receptor-binding residues depends entirely on the disulfide-bonded A+B scaffold.

Two sets of B chain residues are critical for receptor binding, established through decades of structure–function studies (De Meyts 2015):

• Receptor contact residues (Site 1): B24(Phe), B25(Phe), B26(Tyr), B12(Val), B16(Tyr), and B1(Phe). Alanine substitution at B24 or B25 reduces binding affinity by more than 90%.
• C-terminal conformational dynamics: The segment B22–B30 exists in a folded-back β-strand configuration in stored (hexameric) insulin but must peel away from the A chain core when insulin binds its receptor — allowing B24–B26 to insert into the receptor's L1/αCT interface. This structural switch was predicted biochemically for decades before the receptor-bound crystal structure confirmed it.

Intact insulin binds its receptor with picomolar affinity and exhibits negative cooperativity (the second insulin molecule binds with roughly 100-fold lower affinity than the first). Receptor activation triggers the PI3K/Akt and Ras/MAPK pathways, mediating glucose uptake in muscle and adipose tissue, glycogen synthesis, and suppression of hepatic gluconeogenesis (De Meyts 2015). The two IR isoforms — IR-A and IR-B, differing by inclusion or exclusion of a receptor exon that contacts B chain residues — have subtly different insulin binding kinetics and downstream signaling profiles, with IR-A showing stronger mitogenic output (Belfiore and colleagues 2017).

Pharmaceutical modification of B chain residues has produced analogs with dramatically different pharmacokinetics: rapid-acting analogs (lispro: B28/B29 swap; aspart: B28Asp; glulisine: B3Lys→Asn plus B29Glu→Lys) disrupt hexamer self-association to accelerate absorption; long-acting analogs (glargine: two Arg residues appended after B30; detemir and degludec: B30 deleted with fatty acid conjugated to B29Lys) slow dissolution or extend albumin binding.

Evidence

• In vitro / structural: De Meyts (2015, BioEssays) synthesizes four decades of structure–function studies on the insulin–receptor interface, including interpretation of the receptor-bound crystal structures. Key findings: B24(Phe) and B25(Phe) are the dominant receptor-contact residues (>90% binding loss on alanine substitution); the B22–B30 segment undergoes the conformational displacement required for receptor engagement; the biphasic Scatchard binding curve reflects negative cooperativity driven by conformational changes in the receptor upon first ligand binding (De Meyts 2015).

• Receptor isoforms and signaling: Belfiore and colleagues (2017, Endocrine Reviews) review IR-A and IR-B isoform biology. The receptor exon 11 region of αCT contacts B chain residues at Site 1, explaining differential binding kinetics between isoforms. IR-A, which lacks exon 11, has higher insulin affinity and stronger mitogenic signaling than IR-B — relevant to insulin signaling in cancer and fetal development (Belfiore and colleagues 2017).

• Sequence determination: Sanger (1959, Science) describes the complete primary structure determination of the bovine B chain and the three disulfide bond positions. The B chain was the first chain sequenced; the methodology established proved applicable to all protein sequencing that followed. Species comparison showed human and bovine B chains are identical (Sanger 1959).

• Human: The isolated B chain is not used therapeutically. Clinical trial data for intact insulin therapy spans decades and thousands of trials; the B chain as an isolated research target appears primarily in immunology studies of the B:9-23 autoantigenic epitope in type 1 diabetes.

Myths and misconceptions

• "Insulin B chain can be used therapeutically to treat insulin deficiency" — The isolated B chain has essentially no insulin receptor binding affinity without the A chain. The receptor-binding surface requires the complete disulfide-bonded A+B scaffold. Administering isolated B chain would not lower blood glucose. All therapeutic insulins use the intact disulfide-bonded dimer.
• "Insulin analogs are modified B chains with a different A chain" — Most rapid-acting analogs (lispro, aspart, glulisine) modify B chain residues only; the A chain is identical to native human. Long-acting analogs also primarily modify the B chain. A chain changes are uncommon in approved analogs (glargine adds A21Gln→Asn alongside B chain modifications).
• "The B chain's C-terminal Thr30 is critical for receptor binding" — B30(Thr) is dispensable for receptor binding; detemir and degludec both delete B30 without loss of receptor affinity. The critical C-terminal binding residues are B24(Phe), B25(Phe), and B26(Tyr), which are retained in all approved analogs.

Common questions

What is the structural role of the B chain central α-helix (B9–B19)? The B9–B19 α-helix (SHLVEALYLVC) is the most structurally conserved element of insulin across species and across stored, solution, and receptor-bound states. It forms the hydrophobic core of the insulin monomer together with the A chain helices, and its orientation establishes the geometry of the receptor-binding surface. The helix contributes B12(Val) and B16(Tyr) as receptor-contact residues.

How does the B chain C-terminus switch conformation for receptor binding? In the hexameric storage form (T-state), residues B20–B30 fold back toward the A chain, burying B24–B26 at the dimer interface. Receptor binding requires B22–B30 to peel away, allowing B24(Phe), B25(Phe), and B26(Tyr) to engage the receptor's L1 domain. Rapid-acting analogs like lispro and aspart destabilize the T-state fold at B28–B29, pre-populating conformations closer to the receptor-bound state and accelerating association kinetics.

Why are the B chain receptor-binding residues concentrated at B24–B26, not at the N-terminus? Structure–function studies from multiple groups, confirmed by crystal structures, show B chain N-terminal residues (B1–B5) contribute minimally to receptor affinity — they mainly influence self-association geometry. The primary receptor interface is built by B12, B16, B24, B25, and B26 on the B chain, together with A1–A3, A19, and A21 on the A chain. This receptor-binding surface is only assembled when both chains are properly disulfide-bonded and folded.

Related peptides

• Insulin A chain — the 21-aa partner chain; A+B disulfide-bonded dimer constitutes intact insulin; A chain carries the intra-chain A6–A11 disulfide and contributes residues A1–A3 and A19–A21 to receptor Site 1
• Semaglutide — GLP-1 receptor agonist that stimulates insulin secretion from pancreatic beta cells; same therapeutic context (type 2 diabetes, obesity) but distinct mechanism from insulin itself
• Glucagon — counter-regulatory hormone from pancreatic alpha cells; raises blood glucose in opposition to insulin; part of the same islet hormone axis