pe
pep-10608 v1 CC-BY-SA-4.0

Amylin: hunger-suppressing pancreas hormone (hamster research form)

A natural hormone released with insulin after meals that slows digestion, curbs appetite, and helps control blood sugar; this is the Chinese hamster version, used only as a lab research tool.

statussynthesized targetCALCR length37 aa refs4
snapshot sequence_only 10% confidence
Class
Islet amyloid polypeptide (IAPP) — species variant
Status
No approved therapeutic status identified
Main caveat
Chinese hamster IAPP sequence only. No bioactivity, animal, or human evidence is attached to this card's source file.
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.638
pTM0.720
avg pLDDT59.6
ranking score0.605
STRUCTURE · PEP-10608 × CALCR
ranking0.605
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence37 aa
1510152025303537
KCNTATCATQRLANFLVHS NNNLGPVLSPTNVGSNTY
in the news 274 articles
overview readme

What this is

Amylin (also called islet amyloid polypeptide, or IAPP) is a 37-amino-acid hormone secreted by the insulin-producing beta cells of the pancreas. It is co-released with insulin at mealtimes and plays a central role in telling the body it has eaten — slowing digestion, suppressing glucagon, and reducing appetite. The sequence stored here is the Chinese hamster form of IAPP, which differs from the human sequence in a specific mid-molecule region; crucially, that divergence means the hamster version does not form the amyloid plaques seen with human IAPP, making it a valuable research tool (Betsholtz et al. 1989). Like all native IAPP sequences, the active hormone also carries a C-terminal amide (–NH₂) and a Cys2–Cys7 disulfide bond that are not encoded in the stored single-letter sequence.

History

Human IAPP was identified in the late 1980s as the peptide component of the amyloid deposits found in the pancreatic islets of patients with type 2 diabetes. Comparative sequencing of mouse, rat, and hamster IAPP quickly followed, revealing that rodent species — which rarely develop islet amyloid — carry a distinct sequence in the region responsible for fibril formation. Betsholtz and colleagues (1989) deduced the hamster IAPP sequence and confirmed, using synthetic peptides, that this divergent region explains why hamster IAPP fails to aggregate into amyloid the way human IAPP does. This difference has made rodent IAPP sequences important surrogates for studying amylin's hormonal function without the confounding variable of aggregation.

The amylin receptor is not a single protein but a complex: calcitonin receptor (CTR) paired with one of three receptor activity-modifying proteins (RAMP1, RAMP2, or RAMP3), forming the AMYR1, AMYR2, and AMYR3 subtypes. This assembly, and how CTR and its RAMP partners are modulated allosterically, was reviewed in depth in Advances in Pharmacology (2020). The receptor interaction mechanisms for both calcitonin and amylin peptides were further characterized by Lee and colleagues (2016) in the Journal of Biological Chemistry.

What it does

Amylin works alongside insulin to fine-tune the body's response to a meal. When released from beta cells, it slows gastric emptying (keeping food from rushing into the bloodstream), suppresses the release of glucagon (a hormone that raises blood sugar), and signals satiety centers in the brainstem. Together, these actions blunt post-meal glucose spikes and reduce overall food intake. In type 1 diabetes, beta cells are destroyed and amylin is essentially absent, creating a gap that insulin replacement alone cannot fill. In type 2 diabetes, amylin secretion is impaired relative to body weight.

The primary receptor for amylin is CTR combined with RAMPs, forming heterodimeric amylin receptors (AMYRs). CTR itself was shown to have a physiological role in calcium homeostasis — mice lacking the calcitonin receptor become hypercalcemic under calcium challenge (Davey et al. 2008), illustrating how the same receptor family serves distinct regulatory functions depending on which ligand and RAMP partner are engaged.

Evidence

  • Human: Pramlintide (Symlin), a synthetic amylin analog approved by the FDA as an adjunct to insulin therapy in both type 1 and type 2 diabetes, demonstrates the clinical relevance of the amylin signaling axis. The hamster IAPP sequence stored here is a research-grade reference compound, not itself a clinical agent.
  • Animal: Rodent models expressing the hamster IAPP sequence have been used to separate the hormonal effects of amylin from the toxicity associated with human amyloid-forming IAPP, providing cleaner readouts of receptor biology.
  • In vitro: Lee and colleagues (2016) characterized the molecular interactions between amylin-family peptides and their calcitonin-family receptors, clarifying binding determinants at the amylin receptor complex.

Known effects

  • Satiety signaling — Mechanistic (area postrema / brainstem circuits); preclinical and inferred from pramlintide human data
  • Post-meal glucagon suppression — Demonstrated with pramlintide in clinical use; mechanism shared by native amylin
  • Slowing of gastric emptying — Demonstrated with pramlintide; mechanism shared by native amylin
  • Calcium homeostasis — Calcitonin receptor-mediated; preclinical (Davey et al. 2008)
  • Non-amyloidogenic aggregation profile (hamster sequence) — In vitro; Betsholtz et al. 1989

Regulatory status

  • US: Native amylin itself is not approved. Pramlintide (Symlin), a synthetic amylin analog, is FDA-approved as an adjunct to insulin in type 1 and type 2 diabetes.
  • Research use: The Chinese hamster IAPP sequence is used as a non-amyloidogenic surrogate in mechanistic and receptor pharmacology studies.

Mechanism

Amylin acts on a family of heterodimeric class B G protein-coupled receptors formed by CTR co-assembled with RAMP1, RAMP2, or RAMP3 — yielding the AMYR1, AMYR2, and AMYR3 subtypes respectively. RAMPs function as allosteric modulators that alter the pharmacology of CTR, shifting its ligand selectivity from calcitonin toward amylin (Advances in Pharmacology 2020). The peptide interaction determinants at the receptor were mapped by Lee and colleagues (2016), who characterized how calcitonin- and amylin-class peptides engage overlapping but pharmacologically distinct binding surfaces on the CTR/RAMP complex.

The hamster IAPP sequence (KCNTATCATQRLANFLVHSNNNLGPVLSPTNVGSNTY) is 37 residues. The Cys2–Cys7 disulfide creates a small N-terminal ring that is part of the receptor-engaging pharmacophore. The C-terminal amide, not visible in the stored sequence, is required for full receptor activity. A specific mid-molecule region is where the hamster sequence diverges from the human sequence, eliminating the aggregation-prone segment responsible for islet amyloid formation in humans and cats (Betsholtz et al. 1989).

Open questions

  • Whether the hamster IAPP sequence can serve as a non-toxic backbone for designing next-generation amylin receptor agonists
  • Full characterization of AMYR subtype selectivity (AMYR1/2/3) for native vs. modified amylin sequences
  • Structural basis for how RAMPs allosterically reprogram CTR ligand preference at atomic resolution

Related peptides

  • Amylin (mouse/rat) — endogenous rodent IAPP sequence; differs from this hamster form in a few residues but shares the non-amyloidogenic profile used in preclinical studies
  • Cagrilintide — lipidated long-acting amylin analog under clinical investigation for obesity, designed to activate CTR and amylin receptors with once-weekly pharmacokinetics
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.637701153755188 boltz-2
ranking score 0.6045779585838318 boltz-2
▸structural qualityopenfold3
metricvaluenote
gpde1.399global PDE — lower = better
disorderNaNfraction disordered
▸3-letter notation
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Asn-Asn-Asn-Leu-Gly-Pro-Val-Leu-Ser-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
▸recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights—
hardwarenvidia_nim_api
mlx version—
python—
random seed—
msa strategynone
diffusion samples1
runtime—
predicted bymlx@peptide
predicted at2026-04-24
▸citationbibtex
peptidemodel (2026). Amylin: hunger-suppressing pancreas hormone (hamster research form) (pep-10608, v1). PeptideModel. https://peptidemodel.com/card/pep-10608
@peptide{pep10608,
  sequence = {KCNTATCATQRLANFLVHSNNNLGPVLSPTNVGSNTY},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 131 on ct.gov · 1 on EUCTR · checked 2026-05-09
ct.gov trials 131
with results 58
EUCTR 1
PubMed reviews 1
by phase
1phase 11phase 26phase 32no phase
by status
7completed2terminated1unknown
references 4 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use