pe
pep-10609 v1 CC-BY-SA-4.0

Amylin (mouse/rat): safer rodent form of the meal-time blood-sugar hormone

The mouse and rat version of amylin, a hormone released with insulin after eating that slows digestion and reduces appetite; used in lab research and as the template for pramlintide, an FDA-approved diabetes drug.

statussynthesized targetCALCR length37 aa refs2
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.721
pTM0.704
avg pLDDT52.3
ranking score0.815
STRUCTURE · PEP-10609 × CALCR
ranking0.815
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence37 aa
1510152025303537
KCNTATCATQRLANFLVRS SNNLGPVLPPTNVGSNTY
in the news 225 articles
overview readme

What this is

Amylin (mouse, rat) is the rodent form of a 37-amino-acid hormone that pancreatic beta cells co-secrete with insulin after a meal. In rats and mice the peptide carries six amino-acid substitutions relative to human amylin (most consequentially at positions 25, 28, and 29) that prevent it from clumping into the toxic fibrils its human counterpart forms — and that prevention is exactly why this rodent sequence has been studied for decades as a non-amyloidogenic reference peptide and as the structural template for the only FDA-approved amylin drug, pramlintide. The mature peptide carries a C-terminal amide and an intramolecular disulfide bond between Cys2 and Cys7; neither modification is visible in the raw 37-letter sequence shown on this card.

History

Amylin was identified in the mid-1980s as the principal protein constituent of islet amyloid deposits seen in pancreases of people with type-2 diabetes — a finding that linked a then-unknown peptide to a long-puzzling histological feature of the disease (Leffert and colleagues, PNAS, 1989). The rat amylin cDNA was cloned shortly afterward, showing that the peptide is generated by proteolytic processing of a 93-amino-acid precursor expressed selectively in pancreatic islets and bordered by dibasic cleavage sites in a pattern resembling that of calcitonin gene-related peptide (Leffert and colleagues, PNAS, 1989). Recognition that the rat sequence resisted amyloid formation while retaining biological activity made it the design starting point for pramlintide, in which the proline-containing residues at positions 25, 28, and 29 of rat amylin were grafted into the human backbone to yield a soluble, non-aggregating analog that the FDA approved in 2005 (Hoogwerf and colleagues, Drug Design, Development and Therapy, 2008).

What it does

In vivo, amylin acts as a satiety and glucose-regulatory hormone: it slows gastric emptying, suppresses glucagon release, and signals meal-related satiety to the brainstem. Its rodent form is widely used in preclinical pharmacology because it produces these effects without the cytotoxic aggregation that complicates work with human amylin. The peptide engages a family of receptors built from the calcitonin receptor (CALCR) in complex with one of three receptor activity-modifying proteins (RAMP1, RAMP2, or RAMP3), generating the AMY1, AMY2, and AMY3 receptor subtypes — high-affinity amylin receptors that do not exist without the RAMP partner (Hay and colleagues, Pharmacological Reviews, 2015; Poyner and colleagues, Pharmacological Reviews, 2002). Although amylin receptors share the calcitonin receptor core with calcitonin signaling, amylin's primary physiological role is metabolic rather than skeletal.

Mechanism

The amylin receptor complex couples primarily to Gαs, raising intracellular cAMP, with Gq-mediated ERK1/2 phosphorylation and Ca²⁺ mobilization as secondary signaling outputs (Hay and colleagues, Pharmacological Reviews, 2015). The six rodent-specific substitutions that distinguish this peptide from human amylin — at positions 18, 23, 25, 26, 28, and 29 — cluster in the central "amyloidogenic core" region (residues roughly 18–29); proline substitutions at 25, 28, and 29 in particular act as helix- and β-sheet-breaking residues that prevent the conformational transitions required for fibril nucleation, which is why rodents do not develop islet amyloid even though they express amylin at physiological concentrations (Cao and colleagues, FEBS Letters, 2013). Reversing those substitutions one at a time in rat amylin (for example R18H, L23F, or V26I) is sufficient to restore fibril-forming competence, identifying the central region as the molecular switch for amyloidogenicity (Green and colleagues, Journal of Molecular Biology, 2003).

Evidence

  • Human: No clinical trials of native rodent amylin in humans. The rat-amylin-derived analog pramlintide is FDA-approved as adjunctive therapy with insulin for type 1 and type 2 diabetes (Hoogwerf and colleagues, Drug Design, Development and Therapy, 2008).
  • Animal: Foundational work characterizing tissue-specific amylin expression and precursor processing in rat pancreatic islets established the peptide as a beta-cell co-secretion product (Leffert and colleagues, PNAS, 1989). Subsequent studies showed rat amylin influences endocrine but not exocrine pancreatic function in vivo.
  • In vitro: Under standard physiological buffers rat amylin does not form amyloid fibrils and is non-cytotoxic, in direct contrast to the human sequence; under non-physiological conditions (e.g., Tris-HCl buffer with extended incubation) it can be coaxed into fibril formation, and the resulting fibrils show cytotoxicity to pancreatic and neuronal cells that is blocked by the amylin-receptor antagonist AC187 (Milton and Harris, Micron, 2013).

Known effects

  • Satiety and gastric-emptying signaling — Established mechanism in rodent and human studies (pramlintide as the clinical translation).
  • Glucagon suppression — Established mechanism; basis for pramlintide's postprandial glucose-control indication.
  • Non-amyloidogenic reference peptide — Widely used in vitro control for studies of human amylin aggregation and IAPP-related cytotoxicity.

Regulatory status

  • US: This rodent sequence is a research reagent, not a therapeutic. The structurally related human-sequence analog pramlintide (Symlin) was FDA-approved in March 2005 as an adjunct to insulin for type 1 and type 2 diabetes.
  • EU: Native rodent amylin has no marketing authorization; pramlintide was not authorized by the EMA.
  • WADA: Not on the WADA Prohibited List as a named substance.

Related peptides

  • Human amylin (IAPP) — differs from rat amylin at six residues; the amyloidogenic counterpart implicated in type-2-diabetes islet amyloid.
  • Pramlintide — synthetic analog combining the human amylin backbone with three proline substitutions (positions 25, 28, 29) borrowed from rat amylin to confer solubility; the only FDA-approved amylin drug.
  • Cagrilintide — long-acting amylin analog under clinical development in combination with semaglutide for obesity.
  • Calcitonin gene-related peptide (CGRP) — closest sequence relative; shares the calcitonin-receptor–RAMP receptor architecture.
  • Calcitonin — defines the receptor (CALCR) at the core of the amylin receptor complex.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7213800549507141 openfold3-mlx
ranking score 0.8148210644721985 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.885global PDE — lower = better
disorder0.194fraction disordered
chain pair ipTM (A, B)0.721interface quality
3-letter notation
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime464s
predicted bymlx@peptide
predicted at2026-04-24
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). Amylin (mouse/rat): safer rodent form of the meal-time blood-sugar hormone (pep-10609, v1). PeptideModel. https://peptidemodel.com/card/pep-10609
@peptide{pep10609,
  sequence = {KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 131 on ct.gov · 1 on EUCTR · checked 2026-05-22
ct.gov trials 131
with results 58
EUCTR 1
PubMed reviews 1
by phase
1phase 11phase 23phase 31phase 44no phase
by status
7completed1recruiting1active1terminated
references 2 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use