pe
pep-10575 v1 CC-BY-SA-4.0

GLP-1: the natural gut hormone behind Ozempic-class drugs

A hormone released from the gut after eating that tells the pancreas to release insulin and signals fullness to the brain; the natural template for weight-loss and diabetes drugs like semaglutide. Sold as a lab research tool.

statussynthesized targetGCGR length30 aa refs9
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.858
pTM0.757
avg pLDDT57.0
ranking score0.912
STRUCTURE · PEP-10575 × GCGR
ranking0.912
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence30 aa
151015202530
HAEGTFTSDVSSYLE GQAAKEFIAWLVKGR
in the news 220 articles
overview readme

What this is

GLP-1(7-36) amide is the biologically active form of glucagon-like peptide-1, a hormone released from the gut after eating. It is produced naturally in the small intestine and colon by L cells, which process a precursor protein called proglucagon into several signalling peptides — GLP-1 among them (Lafferty and colleagues, 2021). GLP-1(7-36) amide is the endogenous incretin: it reaches the pancreas and brain within minutes of a meal and amplifies insulin release in a glucose-dependent way, meaning it only boosts insulin when blood sugar is elevated. It is the template molecule from which the entire modern class of GLP-1 receptor agonist drugs — including liraglutide, semaglutide, and exenatide — was engineered. The raw sequence stored here is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (30 residues); the biologically active form carries a C-terminal amide (–NH₂) at Arg30 that is not visible in the one-letter sequence but is essential to receptor binding and proteolytic stability.

History

Glucagon-like peptide-1 was identified in 1983 when molecular cloning of the proglucagon gene revealed that the same precursor encodes both glucagon and two downstream peptide sequences — GLP-1 and GLP-2 — in a tissue-specific pattern (Lafferty and colleagues, 2021). The (7-36) amide truncation was recognized in the late 1980s as the predominant circulating active form; the longer GLP-1(7-37) species also exists but the amidated 7-36 form predominates in human plasma. Work through the 1990s established that the peptide was rapidly inactivated by the enzyme DPP-4, which cleaves the first two residues (His-Ala) within approximately 2 minutes of entering the circulation — explaining why the native hormone cannot be used directly as a drug and motivating a decades-long program to engineer longer-lasting analogs. Donnelly (2012) summarized how understanding the structure and function of GLP-1 and its receptor drove the discovery strategy behind the first approved analogs. That engineering effort produced exenatide (approved 2005), the first GLP-1 receptor agonist to reach clinical use, based on the naturally DPP-4-resistant exendin-4 sequence from Gila monster venom; Parkes and colleagues (2013) reviewed the exenatide development arc. Subsequent liraglutide, semaglutide, and newer agents are fatty-acid-conjugated or otherwise modified human GLP-1 analogs that extend duration from minutes to days or weeks.

What it does

After a meal, L cells in the gut sense incoming nutrients and secrete GLP-1(7-36) amide into the portal circulation. The peptide then acts on multiple tissues simultaneously: it stimulates the pancreas to release more insulin (only when glucose is high), suppresses glucagon secretion from pancreatic alpha cells, slows how quickly the stomach empties food into the intestine, and signals the brain to reduce appetite and promote satiety (Donnelly, 2012). The result is a coordinated, meal-contingent braking system that blunts the post-meal glucose spike. Salehi and colleagues (2010) quantified the contribution of endogenous GLP-1 to insulin secretion in type 2 diabetes, demonstrating that blocking its action with an antagonist reduced post-meal insulin release — confirming that the native hormone remains physiologically active even when the overall incretin response is impaired. Ten Kulve and colleagues (2015) found that endogenous GLP-1 also reduces postprandial activation of central reward and satiety areas in patients with type 2 diabetes, extending the peptide's effects into appetite-regulating brain circuitry.

Evidence

  • Human: Salehi and colleagues (2010) demonstrated a measurable contribution of endogenous GLP-1 to postprandial insulin secretion in type 2 diabetes using a GLP-1 receptor antagonist protocol. Ten Kulve and colleagues (2015) showed postprandial modulation of central satiety circuits by endogenous GLP-1 in type 2 diabetes patients. The extensive clinical evidence for GLP-1 receptor agonist drugs (liraglutide, semaglutide, exenatide) provides indirect validation of the target biology but was generated with engineered analogs, not the native 7-36 amide form itself.
  • Animal: Longuet and colleagues (2008) established that glucagon receptor signalling (the secondary target of this peptide) is required for the normal metabolic adaptation to fasting in mouse models, using glucagon receptor knockout animals — providing mechanistic context for the dual GCGR/GLP-1R target annotation on this card.
  • In vitro: Structural and binding studies have mapped the GLP-1(7-36) amide interaction with the GLP-1 receptor transmembrane domain at residue-level resolution. Yang and colleagues (2016) identified the structural determinants governing binding to the seven-transmembrane domain of GLP-1R, and Zhang and colleagues (2017) resolved the structure of the full-length glucagon class B GPCR, providing the structural framework into which the 7-36 amide sequence docks.

Mechanism

GLP-1(7-36) amide binds the GLP-1 receptor (GLP-1R), a class B G protein–coupled receptor, activating Gαs, elevating cAMP, and triggering PKA-dependent pathways that potentiate glucose-stimulated insulin exocytosis from pancreatic beta cells. The same cAMP cascade promotes beta-cell gene expression, inhibits beta-cell apoptosis, and stimulates beta-cell neogenesis, making the receptor relevant not only to acute insulin secretion but also to longer-term beta-cell mass maintenance (Donnelly, 2012). Graaf and colleagues (2016) provided a comprehensive review of GLP-1 and the class B GPCR family, covering both orthosteric peptide binding and allosteric modulation — the mechanistic foundation underpinning drug design across this target class. The peptide's primary target is GLP-1R; the GCGR annotation on this card reflects modest cross-reactivity with the glucagon receptor, whose role in fasting glucose homeostasis was characterised by Longuet and colleagues (2008). The C-terminal amide is critical: it protects the peptide from carboxypeptidase degradation and contributes to receptor affinity, though it is not represented in the stored 30-residue one-letter sequence. The principal pharmacokinetic liability of the native peptide is DPP-4-mediated N-terminal cleavage (His⁷-Ala⁸ bond) with a plasma half-life of approximately 2 minutes — the fundamental constraint that drove the engineering of all longer-acting GLP-1 analogs.

Known effects

  • Glucose-dependent insulin secretion — established from endogenous hormone physiology; confirmed by receptor antagonist studies in humans (Salehi and colleagues, 2010)
  • Glucagon suppression — reduces glucagon secretion from pancreatic alpha cells; reviewed as part of GLP-1's multi-tissue action profile (Donnelly, 2012)
  • Gastric emptying delay — established from endogenous physiology; reviewed in Donnelly (2012)
  • Central satiety signalling — demonstrated in human imaging studies with endogenous GLP-1 (ten Kulve and colleagues, 2015)
  • Beta-cell protection and neogenesis — mechanistic/preclinical; reviewed in Donnelly (2012)

Regulatory status

  • US: GLP-1(7-36) amide as the native endogenous peptide is not itself an approved drug; it is used as a research tool and reference standard. The GLP-1 receptor agonist drug class it spawned is extensively approved (GLP-1R agonists for type 2 diabetes and obesity management). This card represents the endogenous parent molecule, not a therapeutic product.
  • Research use: Available from commercial peptide suppliers as a synthesis-grade reference compound.
  • WADA: Native GLP-1 is not explicitly listed on the WADA prohibited list; the approved GLP-1R agonist drugs occupy a separate regulatory and sporting-use context.

Related peptides

The GLP-1 agonist drug class descends directly from this sequence. Liraglutide is a fatty-acid-conjugated analog of GLP-1(7-37) — one residue longer at the C-terminus — with an Arg34Lys substitution and a γ-Glu-C16 palmitoyl chain at Lys26 enabling once-daily pharmacokinetics through albumin binding. Semaglutide is a further-engineered version with a C18 fatty diacid chain and greater DPP-4 resistance, enabling once-weekly dosing. The proglucagon precursor also encodes the glucagon peptide (GCGR agonist, primary role in hepatic glucose mobilization) and GLP-2 (intestinotrophic); the interplay among these co-encoded hormones is reviewed in Lafferty and colleagues (2021). Exenatide, derived from the Gila monster venom peptide exendin-4, was the first approved GLP-1R agonist and shares the His-Gly N-terminal motif that confers natural DPP-4 resistance absent from the native GLP-1(7-36) amide sequence (Parkes and colleagues, 2013).

Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could the tiny chemical cap on the end of the natural GLP-1 hormone make it favor useful signals over the ones that dull the receptor over time?

If this holds, it would mean the body's own GLP-1 molecule is naturally tuned to drive insulin release while sidestepping the mechanism that desensitizes the receptor. That insight could guide drug designers to keep, rather than drop, this structural feature when building next-generation diabetes and obesity medicines.

The hypothesis
The C-terminal amide group (-NH2 at Arg30) of GLP-1(7-36) amide selectively stabilizes Gs-coupled signaling over beta-arrestin recruitment at GLP-1R, such that the amidated form is a Gs-biased agonist relative to the non-amidated GLP-1(7-37) species at equivalent receptor occupancy.
Why it’s plausible
The readme states the C-terminal amide contributes to receptor affinity, but its mechanistic role in signal transduction bias is not established. Biased agonism at GLP-1R is an active area of inquiry (axis hits: Jones on biased agonism). The amide adds a hydrogen bond donor and removes the negative charge of a free carboxylate at the C-terminus, which could differentially orient the C-terminal helix within the extracellular domain binding cleft and affect the downstream coupling geometry. Beta-arrestin recruitment leads to receptor internalization and desensitization, whereas Gs coupling drives the therapeutic insulin secretion signal. Gs-bias would mean sustained signaling with less receptor desensitization, directly relevant to therapeutic duration.
Why it matters
If the native amide is a Gs-biased ligand, the natural peptide encodes a selectivity feature that was lost in early analogs but is now being engineered back in; this would reframe the native hormone's physiology as inherently optimized for a particular signaling mode rather than promiscuous activation.
Plausibility.50
Novelty.62
Impact.52
Basis · grounding2 papers · 1 computed/note
[1]
noteThe C-terminal amide is described as essential to receptor binding and proteolytic stability; the stored sequence lacks the amide, indicating the functional form differs from the stored sequence and the amide's signaling role is uncharacterized in the card.
[2]
paper
Axis hit references biased agonism and polymorphic variation at GLP-1R, indicating the receptor supports distinct signaling outputs depending on ligand conformation, consistent with amide-dependent bias.
doi: 10.1007/s13679-025-00623-1
[3]
paper
Notes liraglutide induces slightly higher beta-arrestin recruitment than other agonists, implying GLP-1 receptor agonists differ in bias, which could stem from C-terminal modifications.
doi: 10.1152/physrev.00057.2024
openupdated 2026-06-05

When GLP-1 touches the receptor that glucagon uses to raise blood sugar, does it fully switch that receptor on, or only partway?

If GLP-1 only partially activates the glucagon receptor, some GLP-1-based drugs may affect fasting blood sugar differently than researchers expect. For anyone developing dual-action diabetes drugs, getting this distinction right could change how doses are set and how safety is assessed.

The hypothesis
GLP-1(7-36) amide acts as a biased partial agonist at GCGR rather than a full agonist, stabilizing the receptor in a state distinct from glucagon-bound GCGR, such that its GCGR-mediated cAMP response is capped at substantially less than 50% of the glucagon Emax.
Why it’s plausible
The card annotates GCGR as a primary target, but the readme characterizes the interaction as modest cross-reactivity. The crystal structure of full-length GCGR (Zhang 2017) reveals a stalk-beta-strand conformation unique to GCGR that differs from the GLP-1R architecture. GLP-1(7-36) amide was evolved to engage GLP-1R, not GCGR, and the N-terminal HAEGTF motif that confers GLP-1R selectivity diverges at positions 2-6 from the cognate glucagon sequence. Partial occupancy of the GCGR orthosteric site by a non-cognate ligand would be expected to produce submaximal Gs activation, constituting functional bias. The Longuet 2008 data show GCGR is required for fasting adaptation, implying even partial cross-activation could be physiologically meaningful without being equivalent to glucagon.
Why it matters
If the GCGR annotation is misleading about the nature of activation, the secondary pharmacology of GLP-1-based drugs that retain some native GLP-1 sequence homology may be mistakenly assumed to fully antagonize fasting glucose homeostasis, affecting both safety assessment and dual agonist design.
Plausibility.53
Novelty.50
Impact.47
Basis · grounding2 papers · 1 computed/note
[1]
paper
Crystal structure of full-length GCGR shows the stalk adopts a beta-strand rather than an alpha-helix, indicating a distinct receptor topology that may not accommodate GLP-1(7-36) amide as a full agonist.
doi: 10.1038/nature22363
[2]
noteGCGR annotation is described as reflecting modest cross-reactivity, in contrast to the card's primary-role designation, suggesting functional ambiguity.
[3]
paper
Glucagon receptor knockout mice show disrupted fasting adaptation, contextualizing the biological significance of even partial GCGR activation by GLP-1.
doi: 10.1016/j.cmet.2008.09.008
openupdated 2026-06-05

When chemists change one piece of GLP-1 to stop the body from quickly destroying it, could that change accidentally alter the speed at which the hormone switches on the receptor?

If confirmed, this would explain why drugs like semaglutide and liraglutide behave somewhat differently in clinical practice even when their binding strength looks similar on paper. It could help scientists design more predictable analogs by accounting for structural side effects that go beyond simply extending a drug's lifetime.

The hypothesis
Ala8 (second residue) in GLP-1(7-36) amide is not merely a DPP-4 recognition element but actively nucleates helix formation in the N-terminal segment (residues 7-14), such that substitutions conferring DPP-4 resistance also alter the helix dipole moment in this region and measurably change the activation kinetics at GLP-1R even when intrinsic affinity is maintained.
Why it’s plausible
The DPP-4 cleavage site is the His7-Ala8 bond. Ala is known to have high helix propensity among natural amino acids, and its position at residue 2 of the peptide places it in a context where it could stabilize a short N-terminal helix. The structural free-peptide has a low average pLDDT (57), consistent with disorder in solution, but helical induction upon receptor binding is a known feature of class B GPCR peptide agonists. Substitutions like Aib (alpha-aminoisobutyric acid), used in several clinical analogs, have greater helix-stabilizing effect but altered backbone geometry. If Ala8 contributes to helix nucleation, replacing it changes not just DPP-4 resistance but also the conformational landscape of receptor binding. This is distinct from the known fact that Ala8 substitutions affect DPP-4 cleavage.
Why it matters
Understanding whether DPP-4 resistance substitutions at Ala8 have intrinsic conformational consequences beyond half-life extension would explain observed differences in receptor activation kinetics among analogs (semaglutide versus liraglutide versus exenatide) that cannot be attributed solely to the fatty acid chain.
Plausibility.50
Novelty.52
Impact.50
Basis · grounding1 paper · 2 computed/notes
[1]
structureavg_pLDDT of 57 indicates the free peptide is substantially disordered, consistent with a helix-induction mechanism upon receptor contact where the N-terminal segment is a helix-nucleation site.
[2]
noteDPP-4 cleaves the His7-Ala8 bond with a plasma half-life of approximately 2 minutes; the engineering of analogs focused on protecting this bond, motivating investigation of whether Ala8 serves dual structural roles.
[3]
paper
Comprehensive review of GLP-1R binding determinants identifies N-terminal residue contributions to receptor activation, consistent with conformationally sensitive engagement at positions 1-4 of the peptide.
doi: 10.1124/pr.115.011395
openupdated 2026-06-05

After the body rapidly breaks down GLP-1, could the leftover fragment still keep insulin-producing cells alive, even without triggering insulin release?

If this is true, there is a low-level protective signal running in the background throughout the day that helps preserve the cells that make insulin. This might help explain why some people hold onto functional beta-cell mass for years despite poor GLP-1 levels, and it would add another reason why drugs that slow GLP-1 breakdown could be beneficial beyond just boosting insulin secretion.

The hypothesis
The major DPP-4 cleavage product GLP-1(9-36) amide acts as a weak partial agonist at GLP-1R with selective activity in beta-cell survival (anti-apoptotic) signaling but not in acute insulin secretion, providing a tonic cytoprotective signal during fasting when the intact hormone is absent.
Why it’s plausible
DPP-4 rapidly converts GLP-1(7-36) amide to GLP-1(9-36) amide by cleaving the His7-Ala8 bond, producing a truncated form in high concentrations throughout the day. GLP-1(9-36) amide is generally considered inactive at GLP-1R for insulin secretion, but the receptor coupling mechanism involves sequential effects: initial binding by the C-terminal helix at the extracellular domain is intact even without the first two N-terminal residues, and the cAMP elevation threshold for beta-cell survival is lower than for exocytosis. If GLP-1(9-36) amide can sustain subthreshold cAMP levels sufficient for PKA-dependent anti-apoptotic gene expression (reviewed in Donnelly 2012) but not exocytosis, it would provide continuous beta-cell cytoprotection independent of meal timing. This is distinct from the known finding that GLP-1(9-36) amide is inactive in insulin secretion assays.
Why it matters
If confirmed, this would identify a previously unappreciated cytoprotective mechanism operating continuously via the DPP-4 product, explaining in part why even patients with impaired active GLP-1 secretion retain functional beta-cell mass over years, and would support DPP-4 inhibitors as preserving both signaling pools.
Plausibility.45
Novelty.53
Impact.55
Basis · grounding2 papers · 1 computed/note
[1]
noteDPP-4 cleaves His7-Ala8 with a 2-minute half-life, generating GLP-1(9-36) amide as the dominant circulating form; the readme notes this as a pharmacokinetic liability without addressing the activity of the metabolite.
[2]
paper
Reviews GLP-1 and GLP-2 as proglucagon-derived peptides with therapeutic potential, contextualizing the full spectrum of proglucagon products and their activities.
doi: 10.3389/fendo.2021.689678
[3]
paper
Demonstrates that exendin 9-39 (GLP-1R antagonist) reduces insulin response to intravenous glucose even when plasma GLP-1 was undetectable, consistent with tonic low-level GLP-1R activation between meals.
doi: 10.2337/db09-1253
openupdated 2026-06-05

Could spraying the natural GLP-1 hormone into the nose send it straight to appetite centers in the brain, cutting cravings in obese people without the insulin-related risks of injections?

If this works, it could offer a way to tap the brain's own appetite-suppressing circuitry using the body's natural hormone, no long-acting synthetic analog required. For people who are obese but not diabetic, it might mean an option that targets reward-driven overeating directly while leaving normal blood sugar control untouched.

The hypothesis
Intranasal delivery of GLP-1(7-36) amide at doses sufficient to activate hypothalamic and mesolimbic GLP-1R would suppress food reward behavior in non-diabetic obese individuals with intact peripheral GLP-1 secretion, providing central-only appetite suppression without peripheral insulin secretion side effects.
Why it’s plausible
Ten Kulve 2015 demonstrated that endogenous GLP-1 reduces postprandial activation of central reward and satiety areas in type 2 diabetes patients, with GLP-1R antagonism preventing this effect. The native 7-36 amide has a 2-minute plasma half-life due to DPP-4 cleavage, making it impractical peripherally, but intranasal administration bypasses both the gastrointestinal DPP-4 barrier and the blood-brain barrier via the olfactory route, potentially delivering the unmodified native peptide directly to central GLP-1R populations. Obese non-diabetic individuals have intact peripheral incretin secretion, so adding peripheral GLP-1R agonism would cause glucose-dependent insulin release unnecessarily; direct CNS delivery would decouple reward suppression from metabolic effects. This repurposing hypothesis is non-obvious because the peptide is not currently considered viable for CNS delivery.
Why it matters
If the native unmodified peptide can suppress reward-driven eating via the intranasal route, it would establish a proof of concept for brain-targeted GLP-1 therapy without the engineering required for long-acting analogs, and would help disentangle the relative contributions of peripheral versus central GLP-1R signaling to weight reduction.
Plausibility.43
Novelty.53
Impact.50
Basis · grounding2 papers · 1 computed/note
[1]
paper
Demonstrated that GLP-1R antagonism with exendin 9-39 prevented meal-induced reductions in CNS activation in reward and satiety areas, establishing that endogenous GLP-1 physiologically modulates these circuits.
doi: 10.1007/s00125-015-3754-x
[2]
paper
Axis hit discussing future delivery strategies including sublingual and transdermal routes, indicating that non-injection delivery for GLP-1 peptides is an open engineering challenge, supporting the novelty of intranasal native peptide delivery.
doi: 10.1007/s11883-025-01350-7
[3]
noteStates DPP-4 inactivates the peptide within 2 minutes in circulation, but does not address whether DPP-4 activity in the CNS compartment would similarly degrade intranasally delivered peptide.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8581349849700928 openfold3-mlx
ranking score 0.9118638038635254 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.656global PDE — lower = better
disorder0.148fraction disordered
chain pair ipTM (A, B)0.858interface quality
3-letter notation
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime457s
predicted bymlx@peptide
predicted at2026-04-23
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). GLP-1: the natural gut hormone behind Ozempic-class drugs (pep-10575, v1). PeptideModel. https://peptidemodel.com/card/pep-10575
@peptide{pep10575,
  sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 2 on ct.gov · checked 2026-05-22
ct.gov trials 2
PubMed RCT 12
by phase
2no phase
by status
1active
references 9 papers
[2]
Proglucagon-Derived Peptides as Therapeutics
Lafferty, R. et al. Frontiers in Endocrinology 2021
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use