GLP-1: the natural gut hormone behind Ozempic-class drugs
A hormone released from the gut after eating that tells the pancreas to release insulin and signals fullness to the brain; the natural template for weight-loss and diabetes drugs like semaglutide. Sold as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
GLP-1(7-36) amide is the biologically active form of glucagon-like peptide-1, a hormone released from the gut after eating. It is produced naturally in the small intestine and colon by L cells, which process a precursor protein called proglucagon into several signalling peptides — GLP-1 among them (Lafferty and colleagues, 2021). GLP-1(7-36) amide is the endogenous incretin: it reaches the pancreas and brain within minutes of a meal and amplifies insulin release in a glucose-dependent way, meaning it only boosts insulin when blood sugar is elevated. It is the template molecule from which the entire modern class of GLP-1 receptor agonist drugs — including liraglutide, semaglutide, and exenatide — was engineered. The raw sequence stored here is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (30 residues); the biologically active form carries a C-terminal amide (–NH₂) at Arg30 that is not visible in the one-letter sequence but is essential to receptor binding and proteolytic stability.
History
Glucagon-like peptide-1 was identified in 1983 when molecular cloning of the proglucagon gene revealed that the same precursor encodes both glucagon and two downstream peptide sequences — GLP-1 and GLP-2 — in a tissue-specific pattern (Lafferty and colleagues, 2021). The (7-36) amide truncation was recognized in the late 1980s as the predominant circulating active form; the longer GLP-1(7-37) species also exists but the amidated 7-36 form predominates in human plasma. Work through the 1990s established that the peptide was rapidly inactivated by the enzyme DPP-4, which cleaves the first two residues (His-Ala) within approximately 2 minutes of entering the circulation — explaining why the native hormone cannot be used directly as a drug and motivating a decades-long program to engineer longer-lasting analogs. Donnelly (2012) summarized how understanding the structure and function of GLP-1 and its receptor drove the discovery strategy behind the first approved analogs. That engineering effort produced exenatide (approved 2005), the first GLP-1 receptor agonist to reach clinical use, based on the naturally DPP-4-resistant exendin-4 sequence from Gila monster venom; Parkes and colleagues (2013) reviewed the exenatide development arc. Subsequent liraglutide, semaglutide, and newer agents are fatty-acid-conjugated or otherwise modified human GLP-1 analogs that extend duration from minutes to days or weeks.
What it does
After a meal, L cells in the gut sense incoming nutrients and secrete GLP-1(7-36) amide into the portal circulation. The peptide then acts on multiple tissues simultaneously: it stimulates the pancreas to release more insulin (only when glucose is high), suppresses glucagon secretion from pancreatic alpha cells, slows how quickly the stomach empties food into the intestine, and signals the brain to reduce appetite and promote satiety (Donnelly, 2012). The result is a coordinated, meal-contingent braking system that blunts the post-meal glucose spike. Salehi and colleagues (2010) quantified the contribution of endogenous GLP-1 to insulin secretion in type 2 diabetes, demonstrating that blocking its action with an antagonist reduced post-meal insulin release — confirming that the native hormone remains physiologically active even when the overall incretin response is impaired. Ten Kulve and colleagues (2015) found that endogenous GLP-1 also reduces postprandial activation of central reward and satiety areas in patients with type 2 diabetes, extending the peptide's effects into appetite-regulating brain circuitry.
Evidence
- Human: Salehi and colleagues (2010) demonstrated a measurable contribution of endogenous GLP-1 to postprandial insulin secretion in type 2 diabetes using a GLP-1 receptor antagonist protocol. Ten Kulve and colleagues (2015) showed postprandial modulation of central satiety circuits by endogenous GLP-1 in type 2 diabetes patients. The extensive clinical evidence for GLP-1 receptor agonist drugs (liraglutide, semaglutide, exenatide) provides indirect validation of the target biology but was generated with engineered analogs, not the native 7-36 amide form itself.
- Animal: Longuet and colleagues (2008) established that glucagon receptor signalling (the secondary target of this peptide) is required for the normal metabolic adaptation to fasting in mouse models, using glucagon receptor knockout animals — providing mechanistic context for the dual GCGR/GLP-1R target annotation on this card.
- In vitro: Structural and binding studies have mapped the GLP-1(7-36) amide interaction with the GLP-1 receptor transmembrane domain at residue-level resolution. Yang and colleagues (2016) identified the structural determinants governing binding to the seven-transmembrane domain of GLP-1R, and Zhang and colleagues (2017) resolved the structure of the full-length glucagon class B GPCR, providing the structural framework into which the 7-36 amide sequence docks.
Mechanism
GLP-1(7-36) amide binds the GLP-1 receptor (GLP-1R), a class B G protein–coupled receptor, activating Gαs, elevating cAMP, and triggering PKA-dependent pathways that potentiate glucose-stimulated insulin exocytosis from pancreatic beta cells. The same cAMP cascade promotes beta-cell gene expression, inhibits beta-cell apoptosis, and stimulates beta-cell neogenesis, making the receptor relevant not only to acute insulin secretion but also to longer-term beta-cell mass maintenance (Donnelly, 2012). Graaf and colleagues (2016) provided a comprehensive review of GLP-1 and the class B GPCR family, covering both orthosteric peptide binding and allosteric modulation — the mechanistic foundation underpinning drug design across this target class. The peptide's primary target is GLP-1R; the GCGR annotation on this card reflects modest cross-reactivity with the glucagon receptor, whose role in fasting glucose homeostasis was characterised by Longuet and colleagues (2008). The C-terminal amide is critical: it protects the peptide from carboxypeptidase degradation and contributes to receptor affinity, though it is not represented in the stored 30-residue one-letter sequence. The principal pharmacokinetic liability of the native peptide is DPP-4-mediated N-terminal cleavage (His⁷-Ala⁸ bond) with a plasma half-life of approximately 2 minutes — the fundamental constraint that drove the engineering of all longer-acting GLP-1 analogs.
Known effects
- Glucose-dependent insulin secretion — established from endogenous hormone physiology; confirmed by receptor antagonist studies in humans (Salehi and colleagues, 2010)
- Glucagon suppression — reduces glucagon secretion from pancreatic alpha cells; reviewed as part of GLP-1's multi-tissue action profile (Donnelly, 2012)
- Gastric emptying delay — established from endogenous physiology; reviewed in Donnelly (2012)
- Central satiety signalling — demonstrated in human imaging studies with endogenous GLP-1 (ten Kulve and colleagues, 2015)
- Beta-cell protection and neogenesis — mechanistic/preclinical; reviewed in Donnelly (2012)
Regulatory status
- US: GLP-1(7-36) amide as the native endogenous peptide is not itself an approved drug; it is used as a research tool and reference standard. The GLP-1 receptor agonist drug class it spawned is extensively approved (GLP-1R agonists for type 2 diabetes and obesity management). This card represents the endogenous parent molecule, not a therapeutic product.
- Research use: Available from commercial peptide suppliers as a synthesis-grade reference compound.
- WADA: Native GLP-1 is not explicitly listed on the WADA prohibited list; the approved GLP-1R agonist drugs occupy a separate regulatory and sporting-use context.
Related peptides
The GLP-1 agonist drug class descends directly from this sequence. Liraglutide is a fatty-acid-conjugated analog of GLP-1(7-37) — one residue longer at the C-terminus — with an Arg34Lys substitution and a γ-Glu-C16 palmitoyl chain at Lys26 enabling once-daily pharmacokinetics through albumin binding. Semaglutide is a further-engineered version with a C18 fatty diacid chain and greater DPP-4 resistance, enabling once-weekly dosing. The proglucagon precursor also encodes the glucagon peptide (GCGR agonist, primary role in hepatic glucose mobilization) and GLP-2 (intestinotrophic); the interplay among these co-encoded hormones is reviewed in Lafferty and colleagues (2021). Exenatide, derived from the Gila monster venom peptide exendin-4, was the first approved GLP-1R agonist and shares the His-Gly N-terminal motif that confers natural DPP-4 resistance absent from the native GLP-1(7-36) amide sequence (Parkes and colleagues, 2013).
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could the tiny chemical cap on the end of the natural GLP-1 hormone make it favor useful signals over the ones that dull the receptor over time?
If this holds, it would mean the body's own GLP-1 molecule is naturally tuned to drive insulin release while sidestepping the mechanism that desensitizes the receptor. That insight could guide drug designers to keep, rather than drop, this structural feature when building next-generation diabetes and obesity medicines.
When GLP-1 touches the receptor that glucagon uses to raise blood sugar, does it fully switch that receptor on, or only partway?
If GLP-1 only partially activates the glucagon receptor, some GLP-1-based drugs may affect fasting blood sugar differently than researchers expect. For anyone developing dual-action diabetes drugs, getting this distinction right could change how doses are set and how safety is assessed.
When chemists change one piece of GLP-1 to stop the body from quickly destroying it, could that change accidentally alter the speed at which the hormone switches on the receptor?
If confirmed, this would explain why drugs like semaglutide and liraglutide behave somewhat differently in clinical practice even when their binding strength looks similar on paper. It could help scientists design more predictable analogs by accounting for structural side effects that go beyond simply extending a drug's lifetime.
After the body rapidly breaks down GLP-1, could the leftover fragment still keep insulin-producing cells alive, even without triggering insulin release?
If this is true, there is a low-level protective signal running in the background throughout the day that helps preserve the cells that make insulin. This might help explain why some people hold onto functional beta-cell mass for years despite poor GLP-1 levels, and it would add another reason why drugs that slow GLP-1 breakdown could be beneficial beyond just boosting insulin secretion.
Could spraying the natural GLP-1 hormone into the nose send it straight to appetite centers in the brain, cutting cravings in obese people without the insulin-related risks of injections?
If this works, it could offer a way to tap the brain's own appetite-suppressing circuitry using the body's natural hormone, no long-acting synthetic analog required. For people who are obese but not diabetic, it might mean an option that targets reward-driven overeating directly while leaving normal blood sugar control untouched.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8581349849700928 | openfold3-mlx |
| ranking score | 0.9118638038635254 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.656 | global PDE — lower = better |
| disorder | 0.148 | fraction disordered |
| chain pair ipTM (A, B) | 0.858 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 457s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-23 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10575,
sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR},
target = {gcgr},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}