β-CGRP: natural nerve-signaling peptide of the calcitonin family
A signaling peptide made naturally in the human nervous system; studied in labs to understand blood-vessel dilation and weight-loss pathways; used only as a research tool, not an approved drug.
- Class
- Endogenous neuropeptide; CGRP family
- Status
- No approved therapeutic status identified for this peptide form
- Best-supported effect
- Potent vasodilation and nociceptive signaling established for endogenous CGRP biology (review-level evidence); exogenous administration not studied in this card's source file
- Main caveat
- Source is a catalog description with one review reference; no assay, animal, or human clinical data are attached to this card
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
β-CGRP (beta calcitonin gene-related peptide) is a 37-amino acid signaling peptide found naturally in the human nervous system. It belongs to the calcitonin/CGRP family alongside α-CGRP, amylin, adrenomedullin, and calcitonin itself. Unlike α-CGRP, which is encoded by a distinct exon arrangement, β-CGRP arises from an alternative RNA processing pathway of the same calcitonin gene (Russell and colleagues 2014). The two cysteines near its N-terminus form a disulfide ring — a structural feature of the whole CGRP family that is not visible in the stored linear sequence (Russell and colleagues 2014). In research, human β-CGRP is used as a reference peptide to study the pharmacology of calcitonin and amylin receptors, including their relevance to migraine, cardiovascular regulation, and metabolic disease (Barwell and colleagues 2012).
What it does
β-CGRP acts primarily as a potent vasodilator (Russell and colleagues 2014). Beyond its vascular role, it activates receptors with therapeutic relevance across several conditions — including migraine, cardiovascular disease, osteoporosis, and metabolic disorders such as diabetes and obesity — through its interactions with members of the family B (secretin-like) GPCR superfamily (Barwell and colleagues 2012). Its biological effects depend heavily on which receptor complex it engages: the same 37-residue sequence can produce different functional outcomes depending on the RAMP partner co-expressed by the target cell (Hay and colleagues 2018).
Mechanism
The calcitonin/CGRP receptor family is built around two core GPCRs — the calcitonin receptor (CTR, gene CALCR) and the calcitonin receptor-like receptor (CLR) — which heterodimerize with one of three receptor activity-modifying proteins (RAMP1, RAMP2, RAMP3) to generate pharmacologically distinct receptor subtypes (Hay and colleagues 2018). The canonical CGRP receptor is CLR/RAMP1; the amylin receptor subtypes (AMY₁, AMY₂, AMY₃) are formed by CTR paired with RAMP1, RAMP2, or RAMP3, respectively (Hay and colleagues 2018). β-CGRP can engage both the CGRP receptor and amylin receptor subtypes, making it a useful probe for dissecting interactions at CTR-based complexes — work that is directly relevant to amylin/GLP-1 co-agonism approaches in obesity research. Lee and colleagues (2016) examined the molecular interaction mechanisms underlying how peptides from the calcitonin family bind and activate CTR and amylin receptor complexes. During osteoclast differentiation, CTR expression is upregulated by RANKL, while CLR is transiently enhanced and then reduced, reflecting how the balance of receptor subtypes shifts in bone remodeling contexts (Granholm and colleagues 2008).
Evidence
- Human: No human clinical trials identified for β-CGRP as an administered peptide. Endogenous β-CGRP is studied in the context of migraine pathophysiology; CGRP-targeting therapies (monoclonal antibodies targeting the ligand or receptor) have advanced through clinical development, but these target the broader CGRP system rather than being human β-CGRP itself.
- Animal: β-CGRP's potent vasodilatory properties and protective cardiovascular mechanisms have been characterized in animal models (Russell and colleagues 2014).
- In vitro: Receptor pharmacology studies have established the RAMP-dependent receptor selectivity profile of β-CGRP and related family members (Hay and colleagues 2018; Lee and colleagues 2016).
Known effects
- Vasodilation — Well-characterized in preclinical models; potent and rapid-onset (Russell and colleagues 2014)
- Cardiovascular protection — Proposed protective role described in preclinical and mechanistic studies (Russell and colleagues 2014)
- Receptor pharmacology probe — Used in vitro to define binding and activation profiles at CLR/RAMP1 (CGRP receptor) and CTR/RAMP complexes (amylin receptors) (Hay and colleagues 2018; Lee and colleagues 2016)
- Osteoclast-relevant receptor context — CTR, the primary target listed for this card, is expressed and upregulated during osteoclast differentiation (Granholm and colleagues 2008)
Related peptides
The calcitonin/CGRP family is a closely related group of peptides sharing this receptor architecture. α-CGRP differs from β-CGRP at three amino acid positions and is encoded by the calcitonin gene through a different splice outcome. Amylin (also known as IAPP) acts at the AMY receptor subtypes (CTR+RAMP) that β-CGRP can also engage, and is under active investigation as a co-agonist partner for GLP-1 receptor agonists in weight loss research. Calcitonin itself acts directly at CTR.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does beta-CGRP meaningfully activate the same receptor targeted by semaglutide and liraglutide?
If the GLP-1 receptor link is real, migraine and metabolic disease might share a signaling node. If it is not, doctors combining CGRP-blocking migraine drugs with GLP-1 diabetes drugs likely need not worry about the two competing at the same receptor.
Could a slightly modified, more stable version of beta-CGRP work as a cheaper migraine drug than the antibody treatments on the market?
Current CGRP-targeting migraine-prevention drugs are antibodies costing thousands of dollars per year. If a stabilized peptide version performed similarly, it could lower the cost of preventive migraine treatment for many patients.
Is beta-CGRP a nerve-released molecule that helps tell bone cells to rebuild after a fracture, and could its loss contribute to poor bone healing in diabetic patients?
Diabetic patients with nerve damage often heal fractures slowly, and few drugs help. If beta-CGRP is one of the missing nerve signals, delivering a stabilized version at the fracture site could support healing and reduce the complications that follow.
If you break or remove the ring formed by the two sulfur bridges near the start of beta-CGRP, does it stop activating its receptor and instead block it?
If true, a simple chemical change could turn a naturally activating peptide into a blocker, offering a new design route for migraine-prevention or cardiovascular drugs without building an entirely new molecule.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7098795175552368 | openfold3-mlx |
| ranking score | 0.8383851051330566 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.814 | global PDE — lower = better |
| disorder | 0.268 | fraction disordered |
| chain pair ipTM (A, B) | 0.710 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 467s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-25 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10488,
sequence = {ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF},
target = {calcr},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}