pe
pep-10488 v1 CC-BY-SA-4.0

β-CGRP: natural nerve-signaling peptide of the calcitonin family

A signaling peptide made naturally in the human nervous system; studied in labs to understand blood-vessel dilation and weight-loss pathways; used only as a research tool, not an approved drug.

statussynthesized targetCALCR length37 aa refs5
snapshot sparse 0% confidence
Class
Endogenous neuropeptide; CGRP family
Status
No approved therapeutic status identified for this peptide form
Best-supported effect
Potent vasodilation and nociceptive signaling established for endogenous CGRP biology (review-level evidence); exogenous administration not studied in this card's source file
Main caveat
Source is a catalog description with one review reference; no assay, animal, or human clinical data are attached to this card
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.710
pTM0.682
avg pLDDT42.1
ranking score0.838
STRUCTURE · PEP-10488 × CALCR
ranking0.838
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence37 aa
1510152025303537
ACNTATCVTHRLAGLLSRS GGMVKSNFVPTNVGSKAF
in the news 141 articles
overview readme

What this is

β-CGRP (beta calcitonin gene-related peptide) is a 37-amino acid signaling peptide found naturally in the human nervous system. It belongs to the calcitonin/CGRP family alongside α-CGRP, amylin, adrenomedullin, and calcitonin itself. Unlike α-CGRP, which is encoded by a distinct exon arrangement, β-CGRP arises from an alternative RNA processing pathway of the same calcitonin gene (Russell and colleagues 2014). The two cysteines near its N-terminus form a disulfide ring — a structural feature of the whole CGRP family that is not visible in the stored linear sequence (Russell and colleagues 2014). In research, human β-CGRP is used as a reference peptide to study the pharmacology of calcitonin and amylin receptors, including their relevance to migraine, cardiovascular regulation, and metabolic disease (Barwell and colleagues 2012).

What it does

β-CGRP acts primarily as a potent vasodilator (Russell and colleagues 2014). Beyond its vascular role, it activates receptors with therapeutic relevance across several conditions — including migraine, cardiovascular disease, osteoporosis, and metabolic disorders such as diabetes and obesity — through its interactions with members of the family B (secretin-like) GPCR superfamily (Barwell and colleagues 2012). Its biological effects depend heavily on which receptor complex it engages: the same 37-residue sequence can produce different functional outcomes depending on the RAMP partner co-expressed by the target cell (Hay and colleagues 2018).

Mechanism

The calcitonin/CGRP receptor family is built around two core GPCRs — the calcitonin receptor (CTR, gene CALCR) and the calcitonin receptor-like receptor (CLR) — which heterodimerize with one of three receptor activity-modifying proteins (RAMP1, RAMP2, RAMP3) to generate pharmacologically distinct receptor subtypes (Hay and colleagues 2018). The canonical CGRP receptor is CLR/RAMP1; the amylin receptor subtypes (AMY₁, AMY₂, AMY₃) are formed by CTR paired with RAMP1, RAMP2, or RAMP3, respectively (Hay and colleagues 2018). β-CGRP can engage both the CGRP receptor and amylin receptor subtypes, making it a useful probe for dissecting interactions at CTR-based complexes — work that is directly relevant to amylin/GLP-1 co-agonism approaches in obesity research. Lee and colleagues (2016) examined the molecular interaction mechanisms underlying how peptides from the calcitonin family bind and activate CTR and amylin receptor complexes. During osteoclast differentiation, CTR expression is upregulated by RANKL, while CLR is transiently enhanced and then reduced, reflecting how the balance of receptor subtypes shifts in bone remodeling contexts (Granholm and colleagues 2008).

Evidence

  • Human: No human clinical trials identified for β-CGRP as an administered peptide. Endogenous β-CGRP is studied in the context of migraine pathophysiology; CGRP-targeting therapies (monoclonal antibodies targeting the ligand or receptor) have advanced through clinical development, but these target the broader CGRP system rather than being human β-CGRP itself.
  • Animal: β-CGRP's potent vasodilatory properties and protective cardiovascular mechanisms have been characterized in animal models (Russell and colleagues 2014).
  • In vitro: Receptor pharmacology studies have established the RAMP-dependent receptor selectivity profile of β-CGRP and related family members (Hay and colleagues 2018; Lee and colleagues 2016).

Known effects

  • Vasodilation — Well-characterized in preclinical models; potent and rapid-onset (Russell and colleagues 2014)
  • Cardiovascular protection — Proposed protective role described in preclinical and mechanistic studies (Russell and colleagues 2014)
  • Receptor pharmacology probe — Used in vitro to define binding and activation profiles at CLR/RAMP1 (CGRP receptor) and CTR/RAMP complexes (amylin receptors) (Hay and colleagues 2018; Lee and colleagues 2016)
  • Osteoclast-relevant receptor context — CTR, the primary target listed for this card, is expressed and upregulated during osteoclast differentiation (Granholm and colleagues 2008)

Related peptides

The calcitonin/CGRP family is a closely related group of peptides sharing this receptor architecture. α-CGRP differs from β-CGRP at three amino acid positions and is encoded by the calcitonin gene through a different splice outcome. Amylin (also known as IAPP) acts at the AMY receptor subtypes (CTR+RAMP) that β-CGRP can also engage, and is under active investigation as a co-agonist partner for GLP-1 receptor agonists in weight loss research. Calcitonin itself acts directly at CTR.

Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Does beta-CGRP meaningfully activate the same receptor targeted by semaglutide and liraglutide?

If the GLP-1 receptor link is real, migraine and metabolic disease might share a signaling node. If it is not, doctors combining CGRP-blocking migraine drugs with GLP-1 diabetes drugs likely need not worry about the two competing at the same receptor.

The hypothesis
The GLP-1R annotation for β-CGRP reflects a cross-reactivity mediated by the shared family B GPCR extracellular domain architecture rather than a physiologically relevant primary interaction, meaning β-CGRP binds GLP-1R with substantially lower potency than it binds CALCR/RAMP complexes.
Why it’s plausible
The ipTM of 0.71 against an unspecified receptor complex is only moderate, consistent with a peptide that samples multiple family B GPCR surfaces without high-affinity lock. β-CGRP is established as a CALCR/RAMP1 ligand; GLP-1R shares the same N-terminal ECD fold and peptide-binding groove geometry. Cross-family B GPCR promiscuity is documented for amylin and adrenomedullin paralogs. The GLP-1R annotation may reflect assay conditions rather than selectivity.
Why it matters
If β-CGRP genuinely activates GLP-1R at relevant concentrations, it links migraine biology to insulin-secretion pathways and opens a dual-target angle. If the annotation is artifactual, co-administration of GLP-1 agonists with CGRP-pathway drugs is safe without receptor competition concerns.
Plausibility.78
Novelty.62
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
structureipTM=0.71 suggests moderate but not high-confidence interface with the annotated receptor complex
[2]
noteβ-CGRP acts on family B GPCRs; GLP-1R shares the same receptor class ECD fold
[3]
paper
Pharmacology of AM and AM2/IMD at CGRP, AM1, and AM2 receptors shows family-B cross-reactivity landscape for CGRP-family peptides
doi: 10.1111/bph.14075
openupdated 2026-06-11

Could a slightly modified, more stable version of beta-CGRP work as a cheaper migraine drug than the antibody treatments on the market?

Current CGRP-targeting migraine-prevention drugs are antibodies costing thousands of dollars per year. If a stabilized peptide version performed similarly, it could lower the cost of preventive migraine treatment for many patients.

The hypothesis
β-CGRP's intrinsic disorder (pLDDT 42.1) is the primary pharmacokinetic liability limiting its therapeutic utility as a native peptide, but a stapled or bicyclic analog preserving the disulfide ring and the C-terminal amphipathic helix (residues 23-37) would gain proteolytic stability sufficient for systemic use without receptor-affinity loss.
Why it’s plausible
The pLDDT of 42.1 reflects a peptide that is largely unstructured in isolation, consistent with fly-casting binding behavior. Disordered therapeutic peptides are rapidly degraded by plasma proteases, explaining why CGRP-pathway drugs are monoclonal antibodies (erenumab, fremanezumab) rather than peptide analogs. Residues 23-37 (MVKSNFVPTNVGSKAF) include the predicted receptor-contacting helix; stapling this region while preserving Cys2-Cys7 would reduce conformational entropy and exposure to proteolysis.
Why it matters
A stabilized β-CGRP analog with maintained receptor binding could offer a smaller, cheaper, subcutaneous-injectable alternative to the multi-thousand-dollar antibody biologics currently used for chronic migraine prevention.
Plausibility.72
Novelty.50
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
structurepLDDT=42.1 indicates intrinsic disorder across most of the peptide backbone
[2]
sequenceC-terminal region MVKSNFVPTNVGSKAF (residues ~23-37) contains hydrophobic residues consistent with amphipathic helix formation upon receptor contact
[3]
paper
Non-peptide CGRP receptor antagonists face CYP3A4 inhibition issues; stable peptide analogs could fill this therapeutic gap
doi: 10.1152/physrev.00034.2013
openupdated 2026-06-11

Is beta-CGRP a nerve-released molecule that helps tell bone cells to rebuild after a fracture, and could its loss contribute to poor bone healing in diabetic patients?

Diabetic patients with nerve damage often heal fractures slowly, and few drugs help. If beta-CGRP is one of the missing nerve signals, delivering a stabilized version at the fracture site could support healing and reduce the complications that follow.

The hypothesis
β-CGRP activates CALCR on osteoblasts to promote bone formation at physiologically relevant concentrations, and its relative abundance in sensory nerves innervating bone makes it a candidate endogenous anabolic signal that fracture-repair models would show is rate-limiting for callus remodeling.
Why it’s plausible
The calcitonin receptor on osteoblasts is a known mediator of bone anabolic signaling. β-CGRP is released from sensory nerve endings in periosteum and bone marrow. The readme notes CGRP-family relevance to osteoporosis. Whether the β-isoform specifically, as opposed to α-CGRP or calcitonin, is the dominant paracrine signal at sites of bone repair has not been established. Given that bone innervation density influences healing rate, loss of β-CGRP signal could explain poor fracture healing in peripheral neuropathy.
Why it matters
If β-CGRP is rate-limiting for bone repair, local delivery of stabilized β-CGRP analogs at fracture sites could accelerate healing in diabetic patients with peripheral neuropathy, a major clinical problem with very few effective pharmacological solutions.
Plausibility.60
Novelty.60
Impact.62
Basis · grounding1 paper · 2 computed/notes
[1]
noteβ-CGRP receptor interactions include relevance to osteoporosis through family B GPCR superfamily members including CALCR
[2]
paper
Comprehensive CGRP receptor pharmacology review covering cardiovascular and metabolic roles that imply bone tissue as a relevant target site
doi: 10.1152/physrev.00034.2013
[3]
sequence37-aa sequence with disulfide ring is consistent with a stable secreted signaling peptide compatible with periosteal paracrine signaling range
openupdated 2026-06-11

If you break or remove the ring formed by the two sulfur bridges near the start of beta-CGRP, does it stop activating its receptor and instead block it?

If true, a simple chemical change could turn a naturally activating peptide into a blocker, offering a new design route for migraine-prevention or cardiovascular drugs without building an entirely new molecule.

The hypothesis
The N-terminal disulfide ring (Cys2-Cys7) in β-CGRP enforces a constrained loop that is the primary determinant of receptor selectivity within the CALCR/RAMP family, and truncation or reduction of this ring shifts β-CGRP from agonist to partial agonist or antagonist at CALCR/RAMP1.
Why it’s plausible
The linear sequence ACNTATC contains the disulfide pair at positions 2 and 7. The pLDDT of 42.1 shows the overall peptide is disordered, but the ring constrains the N-terminal region that engages the receptor transmembrane bundle 'message' domain. In α-CGRP pharmacology, ring-open analogs retain binding but lose efficacy. Whether the same applies to the β-isoform, which differs by three residues outside the ring, has not been established.
Why it matters
If the ring is the efficacy switch, oxidation-stable cyclic mimetics of just the ring plus the C-terminal helix could serve as long-acting agonists or antagonists without the metabolic instability of the full 37-mer.
Plausibility.62
Novelty.55
Impact.58
Basis · grounding1 paper · 2 computed/notes
[1]
sequencePositions 2 and 7 are both Cys (ACNTATC), forming the confirmed N-terminal disulfide ring
[2]
noteREADME notes the disulfide ring is a conserved structural feature of the whole CGRP family, not visible in the linear sequence
[3]
paper
Juxtamembranous region of the family B GPCR calcitonin receptor plays a critical role in small-molecule agonist action, implicating the N-terminal peptide domain in efficacy
doi: 10.1111/j.1476-5381.2011.01525.x
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7098795175552368 openfold3-mlx
ranking score 0.8383851051330566 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.814global PDE — lower = better
disorder0.268fraction disordered
chain pair ipTM (A, B)0.710interface quality
3-letter notation
Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime467s
predicted bymlx@peptide
predicted at2026-04-25
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). β-CGRP: natural nerve-signaling peptide of the calcitonin family (pep-10488, v1). PeptideModel. https://peptidemodel.com/card/pep-10488
@peptide{pep10488,
  sequence = {ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 4 by signal overlap
clinical trials 25 on ct.gov · checked 2026-05-09
ct.gov trials 25
with results 8
PubMed reviews 1
by phase
1phase 13phase 21phase 31phase 45no phase
by status
6completed1recruiting1active1not yet recruiting1unknown
references 5 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use