pe
pep-04450 v1 CC-BY-SA-4.0

GLP-1: the gut hormone that inspired Ozempic and Wegovy (natural form)

A natural hormone released in the gut after eating that tells the pancreas to release insulin; the molecule scientists used as a blueprint to create semaglutide and similar weight-loss drugs. Natural hormone, not a drug itself.

statusbioassayed targetGLP-1R length31 aa refs1
endogenous
status 2 / 5 · 0 verified on platform
prediction metrics openfold3-mlx 0.3.1
ipTM0.865
pTM0.753
avg pLDDT53.3
ranking score0.920
STRUCTURE · PEP-04450 × GLP-1R
ranking0.920
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence31 aa
15101520253031
HAEGTFTSDVSSYLEG QAAKEFIAWLVKGRG
in the news 263 articles
overview readme

What this is

GLP-1(7-37) is the 31-amino-acid active form of glucagon-like peptide-1, an intestinal hormone that tells the pancreas to release insulin in response to food. It is produced naturally in the gut after a meal, and it is the molecular scaffold from which GLP-1 receptor agonist drugs such as liraglutide and semaglutide were engineered.

The body generates two closely related active fragments from the same proglucagon precursor: GLP-1(7-37), whose sequence terminates as the free acid, and GLP-1(7-36)amide, which carries a C-terminal amide group instead. Both fragments promote insulin secretion in the isolated pancreas (Molecular Metabolism 2025). A C-terminally amidated reference form, GLP-1(7-37)-NH₂, has a molecular weight of approximately 3,355 Da (Prada Brichtova and colleagues, Soft Matter 2025). The raw sequence stored here (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) represents the free-acid backbone; neither the amide cap nor any acylation is encoded in the single-letter string.

History

The biologically active truncated fragments — GLP-1(7-37) and GLP-1(7-36)amide — were identified after it became clear that the longer, initially characterised precursor form GLP-1(1-37) lacked insulinotropic activity. The N-terminally truncated forms were the species that recognised the pancreatic receptor and drove insulin release (British Journal of Pharmacology 2011). This discovery established GLP-1(7-37) as the reference active peptide and launched a medicinal-chemistry effort to create stabilised analogues with longer half-lives, ultimately producing the GLP-1 receptor agonist drug class.

What it does

GLP-1(7-37) binds the GLP-1 receptor (GLP-1R) on pancreatic beta cells and stimulates insulin release in a glucose-dependent manner — insulin secretion is amplified only when blood glucose is elevated, limiting hypoglycaemia risk. This glucose-dependent insulinotropic property is shared by both GLP-1(7-37) and GLP-1(7-36)amide and has been demonstrated in islet cells in vitro, in perfused pancreata, and in human subjects (ACS Pharmacology & Translational Science 2019; British Journal of Pharmacology 2011).

The N-terminal histidine at position 7 (His7) is essential for this activity. Removing even one residue from the N-terminus — producing GLP-1(8-37) — eliminates the insulinotropic response even though the rest of the sequence is intact. Perfused rat pancreas studies showed GLP-1(7-37) elicited a clear insulin response at 0.1–1 nM, while GLP-1(8-37) did not (British Journal of Pharmacology 2011).

Evidence

  • Human: GLP-1(7-37) and GLP-1(7-36)amide exhibit glucose-dependent insulinotropic activity in human subjects (ACS Pharmacology & Translational Science 2019). As an endogenous hormone rather than a drug candidate, GLP-1(7-37) itself has not been developed into a clinical therapeutic; pharmacological development has focused on stabilised analogues.
  • Animal: Insulin secretion stimulated in perfused rat pancreas at concentrations of 0.1–1 nM (British Journal of Pharmacology 2011).
  • In vitro: Glucose-dependent insulinotropic activity characterised in isolated islet cells (ACS Pharmacology & Translational Science 2019).

Mechanism

GLP-1(7-37) is an agonist of the GLP-1 receptor, a class B G protein-coupled receptor. The free N-terminal His7 is a critical activation determinant: studies in perfused rat pancreas demonstrated that GLP-1(8-37), which lacks His7, has no insulinotropic effect despite sharing the remainder of the sequence (British Journal of Pharmacology 2011).

The peptide's backbone contains two lysine residues — Lys26 and Lys34 — that became key handles for medicinal-chemistry modifications. Attaching a fatty-acid chain to Lys26 via a γ-glutamic acid spacer markedly increases albumin affinity compared with the native peptide, extending circulating half-life and reducing renal clearance; this is the approach used in liraglutide design (Frontiers in Endocrinology 2019). Liraglutide is an acylated hGLP-1(7-37) analogue with the sequence HAEGTFTSDVSSYLEGQAAK(acyl)EFIAWLVRGRG and a C16 (palmitoyl) chain at Lys26 (Biochemical Pharmacology 2020).

Related peptides

  • Semaglutide — a second-generation GLP-1(7-37)-derived analogue with a C18 fatty diacid chain at Lys26, enabling once-weekly dosing; shares the same 31-residue backbone with two amino-acid substitutions for protease resistance.
  • GLP-1(7-36)amide — the C-terminally amidated sibling fragment, co-released from proglucagon and equally active at GLP-1R (molecular weight approximately 3,298 Da in amide form).
  • Liraglutide — the first approved acylated hGLP-1(7-37) analogue; the γ-Glu-C16 chain at Lys26 enables once-daily pharmacokinetics.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.8652577996253967 openfold3-mlx
ranking score 0.9196637272834778 openfold3-mlx
▸structural qualityopenfold3
0
metricvaluenote
gpde0.706global PDE — lower = better
disorder0.154fraction disordered
chain pair ipTM (A, B)0.865interface quality
▸3-letter notation
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime427s
predicted bymlx@peptide
predicted at2026-04-14
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
▸citationbibtex
peptidemodel (2026). GLP-1: the gut hormone that inspired Ozempic and Wegovy (natural form) (pep-04450, v1). PeptideModel. https://peptidemodel.com/card/pep-04450
@peptide{pep04450,
  sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 4018 on ct.gov · 189 on EUCTR · checked 2026-05-22
ct.gov trials ? 4018
with results 737
EUCTR 189
by phase
1phase 11phase 21phase 31phase 41early phase 15no phase
by status
8completed2recruiting
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use