pe
pep-10525 v1 CC-BY-SA-4.0

GLP-1 receptor blocker for research (Exendin 9-39)

A lab tool made from a shortened lizard-venom peptide that blocks the same receptor as Ozempic; used by scientists to test whether a biological effect depends on GLP-1 signaling. Research tool only, not a drug.

statussynthesized targetGLP-1R length31 aa refs9
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.890
pTM0.840
avg pLDDT74.6
ranking score0.775
STRUCTURE · PEP-10525 × GLP-1R
ranking0.775
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence31 aa
15101520253031
DLSKQMEEEAVRLFIE WLKNGGPSSGAPPPS
in the news 218 articles
overview readme

What this is

Exendin (9-39) is a peptide that blocks the GLP-1 receptor — the same receptor activated by drugs like semaglutide and liraglutide. It is a truncated version of exendin-4 (the lizard-venom peptide that exenatide is based on), with the first eight amino acids chopped off, which turns it from an activator into a blocker. Researchers use it as a probe: when they want to know whether a given physiological effect actually depends on GLP-1 receptor signaling, they pre-treat with exendin (9-39) and see what disappears. The stored 31-letter sequence DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS corresponds to residues 9–39 of exendin-4; in much of the published literature it is the C-terminally amidated form, written as "exendin(9-39) amide".

History

Exendin (9-39)'s defining experiment was published by Thorens and colleagues (1993), who cloned the human islet GLP-1 receptor, expressed it in fibroblasts, and tested both peptides from the venom of the Gila monster (Heloderma suspectum): exendin-4 bound the receptor and activated it, while exendin (9-39) bound with similar affinity but did not activate it — establishing the agonist/antagonist pair that has been used ever since (Thorens 1993). The discovery of exendin-4 in that venom is what eventually led to the development of exenatide as the first GLP-1-based diabetes drug (Parkes 2012); exendin (9-39) became its mirror-image research tool.

What it does

Exendin (9-39) occupies the GLP-1 receptor's binding site but does not switch the receptor on. By blocking endogenous GLP-1 from signaling, it lets researchers isolate which physiological responses actually depend on the GLP-1 pathway. In rats, peripheral administration of exendin(9-39) amide accelerated the gastric emptying of a glucose meal — direct evidence that endogenous GLP-1 normally slows gastric emptying in response to nutrients (Imeryüz 1997). In humans, ten Kulve and colleagues (2015) used exendin (9-39) to show that endogenous GLP-1 contributes to postprandial reductions in brain activity in reward and satiety areas in patients with type 2 diabetes — when they blocked the receptor, those central responses to a meal were blunted.

Mechanism

GLP-1R is a class B (secretin-family) G-protein-coupled receptor with a large extracellular N-terminal domain that contributes most of the peptide-ligand binding energy, and a transmembrane core that the agonist N-terminus engages to drive Gαs/cAMP signaling (Donnelly 2012). Exendin (9-39) retains the C-terminal residues that bind the N-terminal extracellular domain but lacks the N-terminal residues of exendin-4 that contact the transmembrane core, which is the structural basis for its competitive-antagonist behavior. Receptor-chimera work has shown that the GLP-1R N-terminal extracellular domain is the principal determinant of ligand selectivity between GLP-1 and glucagon receptors (Runge 2003). Allosteric ligand studies on GLP-1R have further shown that small-molecule modulators can shift the receptor's response to orthosteric peptides like exendin (9-39) in a pathway-selective way, complicating the assumption that the antagonist's effect is uniform across signaling outputs (Koole 2010).

Evidence

  • Human: Used as a pharmacological probe rather than a therapeutic. In a controlled study in patients with type 2 diabetes, infusion of exendin (9-39) blunted the post-meal reduction in activation of central reward and satiety regions, demonstrating that endogenous GLP-1 contributes to those central effects (ten Kulve 2015).
  • Animal: In gastric-fistula rats, peripheral exendin(9-39) amide enhanced glucose-meal gastric emptying, identifying vagal-afferent-mediated central mechanisms downstream of GLP-1R as physiologically active (Imeryüz 1997). It has also been used to test which insulin-secretion stimuli require the GLP-1 pathway — for example, the insulinotropic action of succinic acid dimethyl ester was found to be resistant to exendin(9-39), implying a GLP-1R-independent mechanism (Cancelas 2002).
  • In vitro: In the original cloning study, exendin (9-39) bound the human islet GLP-1 receptor with affinity similar to exendin-4 but failed to stimulate adenylate cyclase, defining it as a competitive antagonist at GLP-1R (Thorens 1993).

Known effects

  • GLP-1 receptor antagonism — Established pharmacological tool (Thorens 1993).
  • Reverses GLP-1-driven slowing of gastric emptying — Preclinical, rat (Imeryüz 1997).
  • Blunts endogenous GLP-1's central satiety/reward signaling — Mechanistic human study (ten Kulve 2015).
  • Brain uptake of GLP-1R-binding peptides — Pharmacokinetic context for incretin-receptor ligands in CNS contexts including Alzheimer's and Parkinson's research (Salameh 2020).

Regulatory status

Exendin (9-39) is a research-use peptide. It is not an approved medicine in any major jurisdiction and is used in academic and preclinical pharmacology to dissect GLP-1 receptor-dependent effects. (No regulatory approvals; no compendial monograph at the time of writing.)

Related peptides

  • Exendin-4 (exenatide) — the parent peptide; agonist at GLP-1R (Thorens 1993, Parkes 2012). Exendin (9-39) is exendin-4 with residues 1–8 removed.
  • GLP-1 (7-36) amide — the endogenous intestinal hormone whose action exendin (9-39) blocks (Donnelly 2012).
  • Semaglutide, liraglutide, dulaglutide — long-acting GLP-1R agonists developed downstream of the exendin-4/GLP-1R pharmacology that exendin (9-39) helped to characterize.
  • Glucagon — homologous family-B GPCR ligand; receptor-selectivity between glucagon and GLP-1 receptors was mapped using exendin (9-39) and chimeric receptor constructs (Runge 2003).
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does the peptide grip the GLP-1 receptor harder when the receptor is switched off than when it is being activated?

If true, this could help explain why the peptide is such a clean blocker, and might guide the design of better drugs for rare sugar-crash conditions that occur after weight-loss surgery.

The hypothesis
Exendin(9-39) binds the GLP-1 receptor primarily through its extracellular domain (ECD) rather than the transmembrane bundle, giving it higher affinity for the receptor's resting-state conformation than for the active, G-protein-coupled conformation.
Why it’s plausible
The N-terminal helix of exendin-4 (residues 1-8, absent in exendin(9-39)) is the activation 'trigger' that inserts into the transmembrane bundle and stabilizes the active conformation. Exendin(9-39) retains the C-terminal tryptophan cage and alpha-helical mid-region that dock into the ECD. If ECD engagement is intrinsically more stable in the inactive receptor conformation, the truncated peptide would show state-dependent affinity, which would explain why it is a near-perfect competitive antagonist at physiological GLP-1 concentrations despite lacking the activation segment. The high ipTM of 0.88 in the boltz-2 prediction is consistent with a well-defined, stable ECD-dominated binding mode.
Why it matters
Confirming a conformation-selective binding mode would make exendin(9-39) a scaffold for designing biased antagonists that preferentially stabilize the inactive GLP-1R state, which could be useful in contexts where tonic GLP-1R activity is pathological (e.g., post-bariatric hypoglycemia).
Plausibility.75
Novelty.55
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS, the C-terminal APPPS proline-rich stretch and the WLKN motif are present; the N-terminal His-Gly-Glu 'activation triad' of exendin-4 residues 1-8 is absent.
[2]
structureboltz-2 complex ipTM=0.8899 with pLDDT=74.6; high inter-chain confidence despite moderate per-residue confidence is consistent with a structured binding interface concentrated at the ECD.
[3]
noteThorens 1993 established that exendin(9-39) binds GLP-1R with affinity similar to exendin-4 yet does not activate it, implying binding energy is not dependent on the activation segment.
openupdated 2026-06-05

Even though this peptide blocks the main GLP-1 receptor signal, could it still trigger a secondary signaling pathway inside the cell?

If true, scientists using this peptide as a control in long experiments could be inadvertently altering cell behavior, and the finding could open a path to drugs that selectively activate useful GLP-1 signals while avoiding side effects tied to the main pathway.

The hypothesis
Exendin(9-39) has partial agonist activity at GLP-1R specifically through the beta-arrestin recruitment pathway, even though it is a full antagonist of the cAMP/Gs pathway, making it a biased ligand rather than a neutral competitive antagonist.
Why it’s plausible
Class B GPCRs can signal through both Gs-cAMP and beta-arrestin arms, and some peptide fragments that lack the N-terminal activation helix have been shown to recruit arrestin with low efficacy while failing to activate Gs. The sequence DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS retains the mid-helical region that contacts the receptor core, which is implicated in receptor conformational changes linked to arrestin docking. If exendin(9-39) biases GLP-1R toward arrestin-mediated internalization without cAMP production, chronic administration in research settings would downregulate surface GLP-1R over time, complicating interpretation of prolonged blockade experiments.
Why it matters
A biased partial agonist profile would mean exendin(9-39) is not pharmacologically inert and could not be used as a simple antagonist control in chronic settings; it would also validate the GLP-1R mid-domain as a target for designing beta-arrestin-biased therapeutics with different side-effect profiles than cAMP-coupled agonists like semaglutide.
Plausibility.55
Novelty.60
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceLFIEWLKN (residues 14-21) forms the core amphipathic helix present in the stored sequence; this helix contacts the receptor extracellular loops, which are the locus of arrestin-biased signaling in related class B GPCRs.
[2]
structurepLDDT=74.6 averaged over the complex, with the helical region predicted to be more ordered than the C-terminal proline-rich tail, consistent with a structured interface capable of inducing receptor conformational change.
[3]
paper
Wootten et al. 2011 demonstrated that GLP-1R signaling can be differentially modulated, implying pathway-selective engagement by partial ligands is mechanistically plausible at this receptor.
doi: 10.1111/j.1476-5381.2011.01687.x
openupdated 2026-06-05

Is the peptide a blocker rather than an activator because its proline-rich tail physically prevents it from switching the receptor on?

If true, scientists could use this 'proline lock' principle as a design rule to convert other activating peptides into blockers, which would be a broadly useful tool for designing new drugs across an entire family of important receptors.

The hypothesis
The proline-rich C-terminal segment GGPSSGAPPPS (residues 21-31 of the stored sequence) acts as a conformational spacer that prevents the mid-helix from adopting a fully active receptor-triggering geometry, and replacing these prolines with alanines would convert exendin(9-39) from antagonist to partial agonist.
Why it’s plausible
Proline residues break alpha-helical hydrogen bonding and impose rigidity. The stored sequence contains three prolines in the C-terminal stretch (P24, P27, P30 in GGPSSGAPPPS). In exendin-4, the equivalent C-terminal prolines form the 'tryptophan cage' miniprotein fold; in the truncated exendin(9-39) where the activating N-terminal helix is absent, these prolines may act to hold the remaining helix at a fixed angle that prevents the extracellular loop contacts needed for Gs activation. If Pro-to-Ala substitutions relax this constraint and allow the mid-helix to reorient, partial agonism could emerge.
Why it matters
This hypothesis identifies the C-terminal proline cluster as an antagonism-encoding structural element independent of the missing N-terminal activation segment, which would be a novel principle for designing antagonists of other class B GPCRs by engineering proline-rich C-terminal caps onto truncated peptide scaffolds.
Plausibility.45
Novelty.70
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceGGPSSGAPPPS at positions 21-31: three prolines at positions 24, 27, 30 within a 11-residue C-terminal stretch; verified directly from DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS.
[2]
structurepLDDT=74.6 overall with the C-terminal proline-rich region expected to be the most disordered portion, consistent with this region acting as a flexible spacer rather than forming a defined secondary structure contact with GLP-1R.
[3]
noteThe C-terminally amidated form of exendin(9-39) is used in most published literature, indicating the C-terminus is biologically relevant and not merely a passive tail.
openupdated 2026-06-05

Could blocking GLP-1 receptor activity in the brain's immune cells slow down the damaging inflammation seen in Alzheimer's disease?

If true, this peptide, already known to be safe in humans, could point to a new way of treating neuroinflammation in Alzheimer's that works differently from existing approaches, potentially helping patients in later disease stages where current GLP-1 drugs show less benefit.

The hypothesis
Exendin(9-39) could attenuate neuroinflammation in models of Alzheimer's disease independently of its peripheral metabolic effects, by blocking aberrant GLP-1R signaling in activated microglia, which express GLP-1R and use it to regulate cytokine release.
Why it’s plausible
GLP-1R agonists are under active investigation as neuroprotective agents in AD and PD, with effects attributed partly to microglial GLP-1R activation reducing neuroinflammatory cytokine tone. However, in chronic neuroinflammation, sustained GLP-1R activation in microglia may contribute to maladaptive inflammatory polarization. An antagonist that dampens pathological microglial GLP-1R activity, without crossing the BBB robustly (as suggested for related peptides by Kastin and Akerstrom cited in the literature snippet), could modulate neuroinflammation at a different point in the disease course than agonist therapies.
Why it matters
If microglial GLP-1R has a context-dependent pro-inflammatory role in established AD pathology, exendin(9-39) would represent a previously unconsidered tool for the anti-neuroinflammatory niche, complementing rather than competing with GLP-1 agonist neuroprotection strategies that are more relevant at earlier disease stages.
Plausibility.40
Novelty.65
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Reviews GLP-1R agonists as AD and PD therapeutics and discusses Kastin and Akerstrom data on exendin-4 BBB crossing; the limited CNS penetrance of the truncated antagonist would constrain its central action to contexts where the BBB is already compromised, as in neuroinflammatory disease.
doi: 10.1016/j.bcp.2020.114187
[2]
noteExendin(9-39) is described as a probe for whether a physiological effect depends on GLP-1R signaling; this same logic applies to microglial biology where GLP-1R expression and function are increasingly documented.
[3]
sequence31-aa peptide with moderate hydrophobicity; peripheral vs. central distribution would be governed by BBB peptide transport, making CNS availability a tunable property if the scaffold were further engineered.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8899389505386353 boltz-2
ranking score 0.7747513651847839 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.797global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). GLP-1 receptor blocker for research (Exendin 9-39) (pep-10525, v1). PeptideModel. https://peptidemodel.com/card/pep-10525
@peptide{pep10525,
  sequence = {DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 4 by signal overlap
clinical trials 44 on ct.gov · 5 on EUCTR · checked 2026-05-22
ct.gov trials 44
with results 7
EUCTR 5
PubMed RCT 15
by phase
4phase 13phase 21early phase 13no phase
by status
4completed2recruiting4unknown
references 9 papers
[9]
Glucagon-like peptide-1 inhibits gastric emptying via vagal afferent-mediated central mechanisms
I˙meryüz, N. et al. American Journal of Physiology-Gastrointestinal and Liver Physiology 1997
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use