GLP-1 receptor blocker for research (Exendin 9-39)
A lab tool made from a shortened lizard-venom peptide that blocks the same receptor as Ozempic; used by scientists to test whether a biological effect depends on GLP-1 signaling. Research tool only, not a drug.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Exendin (9-39) is a peptide that blocks the GLP-1 receptor — the same receptor activated by drugs like semaglutide and liraglutide. It is a truncated version of exendin-4 (the lizard-venom peptide that exenatide is based on), with the first eight amino acids chopped off, which turns it from an activator into a blocker. Researchers use it as a probe: when they want to know whether a given physiological effect actually depends on GLP-1 receptor signaling, they pre-treat with exendin (9-39) and see what disappears. The stored 31-letter sequence DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS corresponds to residues 9–39 of exendin-4; in much of the published literature it is the C-terminally amidated form, written as "exendin(9-39) amide".
History
Exendin (9-39)'s defining experiment was published by Thorens and colleagues (1993), who cloned the human islet GLP-1 receptor, expressed it in fibroblasts, and tested both peptides from the venom of the Gila monster (Heloderma suspectum): exendin-4 bound the receptor and activated it, while exendin (9-39) bound with similar affinity but did not activate it — establishing the agonist/antagonist pair that has been used ever since (Thorens 1993). The discovery of exendin-4 in that venom is what eventually led to the development of exenatide as the first GLP-1-based diabetes drug (Parkes 2012); exendin (9-39) became its mirror-image research tool.
What it does
Exendin (9-39) occupies the GLP-1 receptor's binding site but does not switch the receptor on. By blocking endogenous GLP-1 from signaling, it lets researchers isolate which physiological responses actually depend on the GLP-1 pathway. In rats, peripheral administration of exendin(9-39) amide accelerated the gastric emptying of a glucose meal — direct evidence that endogenous GLP-1 normally slows gastric emptying in response to nutrients (Imeryüz 1997). In humans, ten Kulve and colleagues (2015) used exendin (9-39) to show that endogenous GLP-1 contributes to postprandial reductions in brain activity in reward and satiety areas in patients with type 2 diabetes — when they blocked the receptor, those central responses to a meal were blunted.
Mechanism
GLP-1R is a class B (secretin-family) G-protein-coupled receptor with a large extracellular N-terminal domain that contributes most of the peptide-ligand binding energy, and a transmembrane core that the agonist N-terminus engages to drive Gαs/cAMP signaling (Donnelly 2012). Exendin (9-39) retains the C-terminal residues that bind the N-terminal extracellular domain but lacks the N-terminal residues of exendin-4 that contact the transmembrane core, which is the structural basis for its competitive-antagonist behavior. Receptor-chimera work has shown that the GLP-1R N-terminal extracellular domain is the principal determinant of ligand selectivity between GLP-1 and glucagon receptors (Runge 2003). Allosteric ligand studies on GLP-1R have further shown that small-molecule modulators can shift the receptor's response to orthosteric peptides like exendin (9-39) in a pathway-selective way, complicating the assumption that the antagonist's effect is uniform across signaling outputs (Koole 2010).
Evidence
- Human: Used as a pharmacological probe rather than a therapeutic. In a controlled study in patients with type 2 diabetes, infusion of exendin (9-39) blunted the post-meal reduction in activation of central reward and satiety regions, demonstrating that endogenous GLP-1 contributes to those central effects (ten Kulve 2015).
- Animal: In gastric-fistula rats, peripheral exendin(9-39) amide enhanced glucose-meal gastric emptying, identifying vagal-afferent-mediated central mechanisms downstream of GLP-1R as physiologically active (Imeryüz 1997). It has also been used to test which insulin-secretion stimuli require the GLP-1 pathway — for example, the insulinotropic action of succinic acid dimethyl ester was found to be resistant to exendin(9-39), implying a GLP-1R-independent mechanism (Cancelas 2002).
- In vitro: In the original cloning study, exendin (9-39) bound the human islet GLP-1 receptor with affinity similar to exendin-4 but failed to stimulate adenylate cyclase, defining it as a competitive antagonist at GLP-1R (Thorens 1993).
Known effects
- GLP-1 receptor antagonism — Established pharmacological tool (Thorens 1993).
- Reverses GLP-1-driven slowing of gastric emptying — Preclinical, rat (Imeryüz 1997).
- Blunts endogenous GLP-1's central satiety/reward signaling — Mechanistic human study (ten Kulve 2015).
- Brain uptake of GLP-1R-binding peptides — Pharmacokinetic context for incretin-receptor ligands in CNS contexts including Alzheimer's and Parkinson's research (Salameh 2020).
Regulatory status
Exendin (9-39) is a research-use peptide. It is not an approved medicine in any major jurisdiction and is used in academic and preclinical pharmacology to dissect GLP-1 receptor-dependent effects. (No regulatory approvals; no compendial monograph at the time of writing.)
Related peptides
- Exendin-4 (exenatide) — the parent peptide; agonist at GLP-1R (Thorens 1993, Parkes 2012). Exendin (9-39) is exendin-4 with residues 1–8 removed.
- GLP-1 (7-36) amide — the endogenous intestinal hormone whose action exendin (9-39) blocks (Donnelly 2012).
- Semaglutide, liraglutide, dulaglutide — long-acting GLP-1R agonists developed downstream of the exendin-4/GLP-1R pharmacology that exendin (9-39) helped to characterize.
- Glucagon — homologous family-B GPCR ligand; receptor-selectivity between glucagon and GLP-1 receptors was mapped using exendin (9-39) and chimeric receptor constructs (Runge 2003).
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does the peptide grip the GLP-1 receptor harder when the receptor is switched off than when it is being activated?
If true, this could help explain why the peptide is such a clean blocker, and might guide the design of better drugs for rare sugar-crash conditions that occur after weight-loss surgery.
Even though this peptide blocks the main GLP-1 receptor signal, could it still trigger a secondary signaling pathway inside the cell?
If true, scientists using this peptide as a control in long experiments could be inadvertently altering cell behavior, and the finding could open a path to drugs that selectively activate useful GLP-1 signals while avoiding side effects tied to the main pathway.
Is the peptide a blocker rather than an activator because its proline-rich tail physically prevents it from switching the receptor on?
If true, scientists could use this 'proline lock' principle as a design rule to convert other activating peptides into blockers, which would be a broadly useful tool for designing new drugs across an entire family of important receptors.
Could blocking GLP-1 receptor activity in the brain's immune cells slow down the damaging inflammation seen in Alzheimer's disease?
If true, this peptide, already known to be safe in humans, could point to a new way of treating neuroinflammation in Alzheimer's that works differently from existing approaches, potentially helping patients in later disease stages where current GLP-1 drugs show less benefit.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8899389505386353 | boltz-2 |
| ranking score | 0.7747513651847839 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.797 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep10525,
sequence = {DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}