GLP-2: natural gut-lining growth hormone (Glucagon-like peptide-2)
A hormone released by the intestine after eating that stimulates gut lining growth and nutrient absorption; the approved drug teduglutide (Gattex) is a modified version used for short bowel syndrome.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
GLP-2 (glucagon-like peptide-2) is a 33-amino acid hormone released by specialised gut cells called L-cells after a meal. It is produced naturally in the human intestine and acts as a growth signal for the gut lining — stimulating the expansion of intestinal villi, promoting nutrient absorption, and protecting the intestinal epithelium from damage. Its best-known clinical descendant is teduglutide, a DPP-4-resistant Gly2 analog that received FDA approval in 2012 for short bowel syndrome. GLP-2 belongs to the proglucagon-derived peptide (PGDP) family, which also includes glucagon, GLP-1, oxyntomodulin, and glicentin, all generated from the same precursor gene by tissue-specific processing (Lafferty and colleagues, 2021).
History
The proglucagon gene was characterised in detail by Bell and colleagues (1983, Nature), who showed that it contains duplicated exons encoding the glucagon-like sequences — a structural observation that predicted the existence of multiple bioactive peptides beyond glucagon itself. The subsequent tissue-specific processing of proglucagon — glucagon from pancreatic alpha cells, GLP-1 and GLP-2 from intestinal L-cells and brainstem neurons — established GLP-2 as a distinct member of the proglucagon-derived peptide family (Lafferty and colleagues, 2021). The discovery that GLP-2 selectively promotes intestinal epithelial growth led to systematic efforts to engineer DPP-4-resistant analogs, ultimately yielding teduglutide (a Gly2 substitution with additional side-chain modifications to reduce proteolytic cleavage), as documented in the class B GPCR therapeutic literature (Lafferty and colleagues, 2021).
What it does
GLP-2 acts on the GLP-2 receptor (GLP-2R), a class B G protein-coupled receptor expressed predominantly on enteric neurons, subepithelial myofibroblasts, and enteroendocrine cells of the small and large intestine. Activation of GLP-2R drives proliferation of intestinal crypt cells, elongation of villi, and enhancement of nutrient transport across the gut epithelium. One well-characterised downstream mechanism involves GLP-2R-bearing subepithelial myofibroblasts releasing keratinocyte growth factor (KGF), which then signals to the overlying epithelium to drive colonic growth (Ørskov and colleagues, 2005, Regulatory Peptides). The net effect is an increase in the absorptive surface area and functional capacity of the gut, an effect that becomes therapeutically significant when large segments of intestine have been lost or are non-functional. In contrast to GLP-1, which is best known for its insulin-secretory and appetite-suppressing actions via GLP-1R, GLP-2 has minimal pancreatic or central nervous system activity at physiological concentrations — its principal biology is intestinal.
Evidence
- Human: Teduglutide, the DPP-4-resistant GLP-2 analog, is FDA-approved (2012) for short bowel syndrome in adults and children, representing the primary clinical evidence base for GLP-2R agonism in humans. Native GLP-2(1-33) itself has a very short plasma half-life due to rapid DPP-4 cleavage and has not been the subject of large clinical programmes, as documented in the proglucagon-derived peptide therapeutic pipeline (Lafferty and colleagues, 2021).
- Animal: GLP-2 administration in animal models stimulates intestinal crypt proliferation and villus growth; colonic growth via KGF from subepithelial myofibroblasts was characterised in animal tissue studies (Ørskov and colleagues, 2005).
- In vitro: GLP-2R biology has been characterised in cell-based systems; the receptor's tissue distribution and downstream signalling are described in the broader class B GPCR literature (Graaf and colleagues, 2016, Pharmacological Reviews).
Known effects
- Intestinal epithelial growth (villus elongation, crypt proliferation) — Preclinical; mechanism characterised in vivo and in vitro (Ørskov and colleagues, 2005)
- Enhancement of nutrient absorption — Preclinical and clinical (via teduglutide approval for short bowel syndrome)
- Gut mucosal protection — Preclinical; via KGF-mediated signalling from subepithelial myofibroblasts
- Short bowel syndrome treatment (via teduglutide analog) — FDA-approved (2012)
Safety signals
Safety data for native GLP-2(1-33) in humans is limited because the peptide has an extremely short plasma half-life due to rapid cleavage at the Ala2 position by dipeptidyl peptidase-4 (DPP-4), making it unsuitable for sustained clinical exposure without structural modification. The safety and adverse event profile relevant to GLP-2R agonism in clinical practice derives primarily from teduglutide trials and its FDA label rather than from native GLP-2 studies. The therapeutic literature characterises native GLP-2's rapid inactivation as the primary pharmacokinetic barrier addressed by the Gly2 substitution in teduglutide (Lafferty and colleagues, 2021).
Regulatory status
- Native GLP-2(1-33): Not approved as a therapeutic; research and investigational use only.
- Teduglutide (Gly2 analog): FDA-approved (2012) for short bowel syndrome; this approval represents the direct clinical translation of GLP-2 biology.
- WADA: Peptide hormones of the proglucagon family fall under the S2 category (peptide hormones, growth factors, related substances).
Mechanism
GLP-2 is a 33-residue peptide generated from proglucagon by post-translational cleavage in intestinal L-cells and certain brainstem neurons. Its sequence (HADGSFSDEMNTILDNLAARDFINWLIQTKITD) shares the conserved N-terminal HXDGSF motif characteristic of the glucagon superfamily, which engages the extracellular domain of class B GPCRs (Runge and colleagues, 2003, BJP; Graaf and colleagues, 2016). GLP-2R is the cognate receptor; unlike the glucagon receptor (GCGR) or GLP-1 receptor (GLP-1R), GLP-2R is expressed primarily in intestinal tissue rather than pancreas or CNS. Upon GLP-2R activation, cAMP-mediated signalling in subepithelial myofibroblasts induces KGF release, and KGF then acts on FGFR2IIIb on adjacent intestinal epithelial cells to drive proliferation (Ørskov and colleagues, 2005). Native GLP-2(1-33) is rapidly inactivated by DPP-4, which cleaves the His1–Ala2 bond, truncating the peptide to the biologically inactive GLP-2(3-33) form; this liability is the pharmacological rationale for the Ala2→Gly2 substitution used to produce teduglutide (Lafferty and colleagues, 2021). The preproglucagon gene's exon-duplicated architecture, described by Bell and colleagues (1983), encodes both GLP-1 and GLP-2 in tandem, explaining their shared N-terminal pharmacophore and divergent receptor selectivity.
Related peptides
- GLP-1(7-37) — the sister proglucagon-derived peptide produced from the same precursor gene in L-cells; acts via GLP-1R to stimulate insulin secretion and suppress appetite rather than driving intestinal growth
- Glucagon — the pancreatic proglucagon product; counter-regulatory hormone for blood glucose via GCGR; shares the glucagon superfamily N-terminal motif with GLP-2
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could GLP-2 prevent the bowel damage that so often makes cancer radiotherapy harder to tolerate?
If GLP-2 shields gut stem cells during radiation, cancer patients could experience far less bowel damage from radiotherapy. This might allow doctors to use higher radiation doses against tumors while keeping patients' quality of life intact.
Could the wobbly C-terminal region of GLP-2 be responsible for selecting which downstream effects the hormone triggers?
If the tail of GLP-2 acts as a selector switch for different cell signals, drug designers could lock it in different shapes to create gut-repair drugs with fewer side effects, giving patients with bowel disease more targeted treatments.
Could GLP-2 help repair the brain's protective barrier when it breaks down in diseases like Alzheimer's or multiple sclerosis?
If GLP-2 repairs the brain's protective lining the way it repairs the gut's, it could open a new treatment approach for brain diseases where that barrier leaks. This would be especially valuable because GLP-2 drugs already have a safety record from gut disease treatment.
Could the physical properties of GLP-2 prevent it from reaching or activating liver receptors the way glucagon does?
Understanding why GLP-2 stays gut-specific would help researchers design safer gut-repair drugs that do not accidentally interfere with blood sugar control, which matters for diabetic patients who also suffer from bowel disease.
Could a small segment of GLP-2 be borrowed to help other peptide drugs pass through the gut wall when taken by mouth?
Many powerful peptide drugs must be injected because they cannot cross the gut lining. If this GLP-2 segment helps peptides stick to and cross gut membranes, it could be added to other drugs to make them work as pills, which would be far more convenient for patients.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7875087261199951 | openfold3-mlx |
| ranking score | 0.8517722487449646 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.755 | global PDE — lower = better |
| disorder | 0.157 | fraction disordered |
| chain pair ipTM (A, B) | 0.788 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 457s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-22 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10569,
sequence = {HADGSFSDEMNTILDNLAARDFINWLIQTKITD},
target = {gcgr},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}