pe
pep-10569 v1 CC-BY-SA-4.0

GLP-2: natural gut-lining growth hormone (Glucagon-like peptide-2)

A hormone released by the intestine after eating that stimulates gut lining growth and nutrient absorption; the approved drug teduglutide (Gattex) is a modified version used for short bowel syndrome.

statussynthesized targetGCGR length33 aa refs8
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.788
pTM0.717
avg pLDDT55.0
ranking score0.852
STRUCTURE · PEP-10569 × GCGR
ranking0.852
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence33 aa
15101520253033
HADGSFSDEMN TILDNLAARDF INWLIQTKITD
in the news 138 articles
overview readme

What this is

GLP-2 (glucagon-like peptide-2) is a 33-amino acid hormone released by specialised gut cells called L-cells after a meal. It is produced naturally in the human intestine and acts as a growth signal for the gut lining — stimulating the expansion of intestinal villi, promoting nutrient absorption, and protecting the intestinal epithelium from damage. Its best-known clinical descendant is teduglutide, a DPP-4-resistant Gly2 analog that received FDA approval in 2012 for short bowel syndrome. GLP-2 belongs to the proglucagon-derived peptide (PGDP) family, which also includes glucagon, GLP-1, oxyntomodulin, and glicentin, all generated from the same precursor gene by tissue-specific processing (Lafferty and colleagues, 2021).

History

The proglucagon gene was characterised in detail by Bell and colleagues (1983, Nature), who showed that it contains duplicated exons encoding the glucagon-like sequences — a structural observation that predicted the existence of multiple bioactive peptides beyond glucagon itself. The subsequent tissue-specific processing of proglucagon — glucagon from pancreatic alpha cells, GLP-1 and GLP-2 from intestinal L-cells and brainstem neurons — established GLP-2 as a distinct member of the proglucagon-derived peptide family (Lafferty and colleagues, 2021). The discovery that GLP-2 selectively promotes intestinal epithelial growth led to systematic efforts to engineer DPP-4-resistant analogs, ultimately yielding teduglutide (a Gly2 substitution with additional side-chain modifications to reduce proteolytic cleavage), as documented in the class B GPCR therapeutic literature (Lafferty and colleagues, 2021).

What it does

GLP-2 acts on the GLP-2 receptor (GLP-2R), a class B G protein-coupled receptor expressed predominantly on enteric neurons, subepithelial myofibroblasts, and enteroendocrine cells of the small and large intestine. Activation of GLP-2R drives proliferation of intestinal crypt cells, elongation of villi, and enhancement of nutrient transport across the gut epithelium. One well-characterised downstream mechanism involves GLP-2R-bearing subepithelial myofibroblasts releasing keratinocyte growth factor (KGF), which then signals to the overlying epithelium to drive colonic growth (Ørskov and colleagues, 2005, Regulatory Peptides). The net effect is an increase in the absorptive surface area and functional capacity of the gut, an effect that becomes therapeutically significant when large segments of intestine have been lost or are non-functional. In contrast to GLP-1, which is best known for its insulin-secretory and appetite-suppressing actions via GLP-1R, GLP-2 has minimal pancreatic or central nervous system activity at physiological concentrations — its principal biology is intestinal.

Evidence

  • Human: Teduglutide, the DPP-4-resistant GLP-2 analog, is FDA-approved (2012) for short bowel syndrome in adults and children, representing the primary clinical evidence base for GLP-2R agonism in humans. Native GLP-2(1-33) itself has a very short plasma half-life due to rapid DPP-4 cleavage and has not been the subject of large clinical programmes, as documented in the proglucagon-derived peptide therapeutic pipeline (Lafferty and colleagues, 2021).
  • Animal: GLP-2 administration in animal models stimulates intestinal crypt proliferation and villus growth; colonic growth via KGF from subepithelial myofibroblasts was characterised in animal tissue studies (Ørskov and colleagues, 2005).
  • In vitro: GLP-2R biology has been characterised in cell-based systems; the receptor's tissue distribution and downstream signalling are described in the broader class B GPCR literature (Graaf and colleagues, 2016, Pharmacological Reviews).

Known effects

  • Intestinal epithelial growth (villus elongation, crypt proliferation) — Preclinical; mechanism characterised in vivo and in vitro (Ørskov and colleagues, 2005)
  • Enhancement of nutrient absorption — Preclinical and clinical (via teduglutide approval for short bowel syndrome)
  • Gut mucosal protection — Preclinical; via KGF-mediated signalling from subepithelial myofibroblasts
  • Short bowel syndrome treatment (via teduglutide analog) — FDA-approved (2012)

Safety signals

Safety data for native GLP-2(1-33) in humans is limited because the peptide has an extremely short plasma half-life due to rapid cleavage at the Ala2 position by dipeptidyl peptidase-4 (DPP-4), making it unsuitable for sustained clinical exposure without structural modification. The safety and adverse event profile relevant to GLP-2R agonism in clinical practice derives primarily from teduglutide trials and its FDA label rather than from native GLP-2 studies. The therapeutic literature characterises native GLP-2's rapid inactivation as the primary pharmacokinetic barrier addressed by the Gly2 substitution in teduglutide (Lafferty and colleagues, 2021).

Regulatory status

  • Native GLP-2(1-33): Not approved as a therapeutic; research and investigational use only.
  • Teduglutide (Gly2 analog): FDA-approved (2012) for short bowel syndrome; this approval represents the direct clinical translation of GLP-2 biology.
  • WADA: Peptide hormones of the proglucagon family fall under the S2 category (peptide hormones, growth factors, related substances).

Mechanism

GLP-2 is a 33-residue peptide generated from proglucagon by post-translational cleavage in intestinal L-cells and certain brainstem neurons. Its sequence (HADGSFSDEMNTILDNLAARDFINWLIQTKITD) shares the conserved N-terminal HXDGSF motif characteristic of the glucagon superfamily, which engages the extracellular domain of class B GPCRs (Runge and colleagues, 2003, BJP; Graaf and colleagues, 2016). GLP-2R is the cognate receptor; unlike the glucagon receptor (GCGR) or GLP-1 receptor (GLP-1R), GLP-2R is expressed primarily in intestinal tissue rather than pancreas or CNS. Upon GLP-2R activation, cAMP-mediated signalling in subepithelial myofibroblasts induces KGF release, and KGF then acts on FGFR2IIIb on adjacent intestinal epithelial cells to drive proliferation (Ørskov and colleagues, 2005). Native GLP-2(1-33) is rapidly inactivated by DPP-4, which cleaves the His1–Ala2 bond, truncating the peptide to the biologically inactive GLP-2(3-33) form; this liability is the pharmacological rationale for the Ala2→Gly2 substitution used to produce teduglutide (Lafferty and colleagues, 2021). The preproglucagon gene's exon-duplicated architecture, described by Bell and colleagues (1983), encodes both GLP-1 and GLP-2 in tandem, explaining their shared N-terminal pharmacophore and divergent receptor selectivity.

Related peptides

  • GLP-1(7-37) — the sister proglucagon-derived peptide produced from the same precursor gene in L-cells; acts via GLP-1R to stimulate insulin secretion and suppress appetite rather than driving intestinal growth
  • Glucagon — the pancreatic proglucagon product; counter-regulatory hormone for blood glucose via GCGR; shares the glucagon superfamily N-terminal motif with GLP-2
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could GLP-2 prevent the bowel damage that so often makes cancer radiotherapy harder to tolerate?

If GLP-2 shields gut stem cells during radiation, cancer patients could experience far less bowel damage from radiotherapy. This might allow doctors to use higher radiation doses against tumors while keeping patients' quality of life intact.

The hypothesis
GLP-2 has unrecognized cytoprotective activity in radiation-induced enteropathy that is mechanistically distinct from its trophic (proliferative) effect, operating through an anti-apoptotic pathway in crypt stem cells that persists even when proliferation is suppressed by radiation, making it a potential radioprotectant for cancer patients receiving abdominal radiotherapy.
Why it’s plausible
GLP-2's well-documented role is trophic: it expands intestinal villi and stimulates crypt cell proliferation. However, the readme notes it protects the intestinal epithelium from damage, which is a broader claim than proliferation alone. Radiation kills rapidly dividing crypt cells via apoptosis and DNA damage checkpoints, conditions under which a purely proliferative signal would be ineffective or even harmful. If GLP-2R signaling in crypt base columnar stem cells activates survival kinase cascades (e.g., PI3K/Akt, MEK/ERK) independently of the cell cycle, GLP-2 could reduce stem cell loss during irradiation windows, accelerating re-epithelialization afterward. This is analogous to the radioprotective mechanism proposed for EGF and IGF-1 in gut models.
Why it matters
Radiation enteropathy affects 50-90% of patients receiving pelvic or abdominal radiotherapy and has no approved preventive pharmacotherapy. A GLP-2 analog given prophylactically during radiation could reduce acute and chronic bowel toxicity, improving quality of life and potentially allowing higher radiation doses to tumors.
Plausibility.65
Novelty.50
Impact.80
Basis · grounding3 computed/notes
[1]
noteGLP-2 described as 'protecting the intestinal epithelium from damage' beyond just stimulating villi growth, suggesting cytoprotective mechanisms separate from trophic effects
[2]
noteTeduglutide is approved for short bowel syndrome, a condition of insufficient epithelial mass; the analog's success validates the GLP-2R axis for epithelial restoration
[3]
sequence33-aa peptide with defined receptor binding; short enough for synthetic modification to extend half-life for prophylactic dosing regimens
openupdated 2026-06-05

Could the wobbly C-terminal region of GLP-2 be responsible for selecting which downstream effects the hormone triggers?

If the tail of GLP-2 acts as a selector switch for different cell signals, drug designers could lock it in different shapes to create gut-repair drugs with fewer side effects, giving patients with bowel disease more targeted treatments.

The hypothesis
The moderate interface confidence of the GLP-2/GLP-2R complex (ipTM 0.79, pLDDT 55) reflects genuine conformational disorder in the GLP-2 C-terminus (residues 20-33: ARDFINWLIQTKITD) rather than a modeling artifact, and this C-terminal flexibility is a functional feature that enables receptor-selective signaling bias rather than a pharmacological liability.
Why it’s plausible
The pLDDT of 55 is in the disordered/uncertain range for AlphaFold-class models, yet the ipTM of 0.79 suggests that the interface itself is moderately well-defined, pointing to disorder localized to the peptide rather than the receptor. Inspection of the sequence shows that residues 20-33 (ARDFINWLIQTKITD) contain a tryptophan (W27) and a cluster of polar/charged residues (R20, D21, K31, T32) that could form a dynamic secondary binding surface. In class B GPCRs, C-terminal peptide domains often contact the extracellular loops and modulate biased agonism. A flexible C-terminus that can adopt multiple poses could produce tissue-specific signaling bias at GLP-2R depending on the local membrane and co-receptor environment.
Why it matters
Biased GLP-2R agonists that selectively drive proliferative vs. cytoprotective vs. motility-related signaling arms could have dramatically different therapeutic profiles for short bowel syndrome, Crohn's disease, and radiation enteritis. Establishing that natural GLP-2's own C-terminal flexibility encodes this bias would make it a template for next-generation analogs.
Plausibility.55
Novelty.65
Impact.70
Basis · grounding3 computed/notes
[1]
structureipTM=0.79 indicates a defined binding interface, but pLDDT=55 indicates high local structural uncertainty in the peptide itself, consistent with intrinsic disorder
[2]
sequenceC-terminal segment ARDFINWLIQTKITD (residues 20-33) contains W27 (aromatic anchor candidate), R20, K31 (cationic), and D21, D33 (anionic), compatible with a flexible electrostatic engagement surface
[3]
noteGLP-2R is the primary annotated target; class B GPCR biology predicts that C-terminal peptide domains modulate receptor conformation and bias
openupdated 2026-06-05

Could GLP-2 help repair the brain's protective barrier when it breaks down in diseases like Alzheimer's or multiple sclerosis?

If GLP-2 repairs the brain's protective lining the way it repairs the gut's, it could open a new treatment approach for brain diseases where that barrier leaks. This would be especially valuable because GLP-2 drugs already have a safety record from gut disease treatment.

The hypothesis
GLP-2's trophic and barrier-protective activity in the gut may extend to the blood-brain barrier choroid plexus epithelium, which shares functional analogy with intestinal epithelium including tight junction regulation and epithelial renewal, suggesting GLP-2R agonism as a strategy to restore compromised blood-brain barrier integrity in neuroinflammatory conditions.
Why it’s plausible
The readme notes that GLP-2 and GLP-1 are both produced by brainstem neurons from the same proglucagon precursor, establishing that GLP-2 is a CNS-active peptide family member. GLP-1R agonism has well-documented neuroprotective effects and GLP-1R is expressed on choroid plexus epithelium. If GLP-2R is co-expressed in this tissue (as the shared proglucagon origin in brainstem neurons suggests), then GLP-2 could regulate choroid plexus epithelial integrity by the same mechanism it regulates intestinal epithelium. Compromised blood-brain barrier integrity is a feature of Alzheimer's disease, multiple sclerosis, and traumatic brain injury, none of which currently have approved barrier-restoration pharmacotherapies.
Why it matters
Repurposing a gut-protective hormone for brain barrier restoration would leverage existing safety data from teduglutide's clinical use. A CNS-penetrant or intrathecally-deliverable GLP-2 analog could address a major unmet need in neuroinflammatory and neurodegenerative disease.
Plausibility.45
Novelty.70
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
noteGLP-2 is produced by brainstem neurons from the proglucagon precursor alongside GLP-1, establishing CNS expression and suggesting CNS receptor targets
[2]
paper
Lafferty et al. 2021 covers proglucagon-derived peptide family including GLP-2 in neuroendocrine context
doi: 10.3389/fendo.2021.689678
[3]
noteAnnotated targets include gcgr; the proglucagon family has broad receptor cross-reactivity patterns in CNS tissue that differ from peripheral patterns
openupdated 2026-06-05

Could the physical properties of GLP-2 prevent it from reaching or activating liver receptors the way glucagon does?

Understanding why GLP-2 stays gut-specific would help researchers design safer gut-repair drugs that do not accidentally interfere with blood sugar control, which matters for diabetic patients who also suffer from bowel disease.

The hypothesis
GLP-2 has a lower net negative charge and higher hydrophobic moment than other proglucagon-derived peptides (glucagon, GLP-1, oxyntomodulin), and this physicochemical profile underlies its selective tropism for intestinal L-cell basolateral receptors over hepatic glucagon receptors, independent of receptor binding affinity per se.
Why it’s plausible
The GLP-2 sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD contains a stretch of hydrophobic residues (ILDNLAARD, FINWLIQ) flanked by charged residues. The annotated targets include gcgr (glucagon receptor), which is primarily hepatic. Proglucagon-derived peptides share the same N-terminal His-Ala-(Glu/Asp) activation motif, so receptor selectivity must be encoded elsewhere. The physicochemical context of delivery (basolateral release from L-cells into a high-albumin portal environment vs. pancreatic alpha-cell secretion into an islet capillary microenvironment) combined with GLP-2's specific hydrophobic core could bias distribution toward the gut-vasculature interface before systemic dilution reduces hepatic exposure. This would mean GCGR annotation reflects a low-affinity pharmacological overlap, not a physiological target.
Why it matters
If GLP-2's selectivity for intestinal vs. hepatic effects is physicochemically rather than purely receptor-affinity-driven, this explains why GLP-2 does not cause the glycemic counter-regulation that full glucagon receptor agonists produce, and vindicates engineering efforts that maintain GLP-2's hydrophobic core while improving stability.
Plausibility.50
Novelty.60
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceSequence contains ILDNLAARD and FINWLIQ as hydrophobic-enriched segments; His1 and Asp9/Glu10/Asp11 create a charged N-terminal activation domain shared with glucagon family members
[2]
noteGLP-2 is released from intestinal L-cells after a meal into the portal circulation; teduglutide is approved for a gut-specific condition, consistent with selective intestinal tropism
[3]
noteAnnotated targets include gcgr alongside glp-2r, raising the question of whether GCGR engagement is physiological or a low-affinity pharmacological artifact
openupdated 2026-06-05

Could a small segment of GLP-2 be borrowed to help other peptide drugs pass through the gut wall when taken by mouth?

Many powerful peptide drugs must be injected because they cannot cross the gut lining. If this GLP-2 segment helps peptides stick to and cross gut membranes, it could be added to other drugs to make them work as pills, which would be far more convenient for patients.

The hypothesis
The internal sequence FINWLIQ (residues 25-31) of GLP-2, which contains a tryptophan flanked by hydrophobic residues, constitutes a latent amphipathic micelle-anchoring motif that could be grafted onto otherwise poorly bioavailable peptide drugs to improve their intestinal epithelial permeation, independent of GLP-2R engagement.
Why it’s plausible
Tryptophan-containing hydrophobic segments in gut-active peptides frequently serve as membrane-anchoring or lipid-raft-targeting motifs. In the GLP-2 sequence, FINWLIQ sits in the C-terminal half that is predicted to be structurally disordered (low pLDDT), suggesting it is not rigidly constrained by the receptor-binding conformation. This positional freedom combined with its amphipathic character raises the possibility that this segment transiently associates with the lipid bilayer in the intestinal lumen, a mechanism that has been exploited in peptide drug delivery. If FINWLIQ retains this membrane-anchoring function when transplanted to heterologous peptides, it could serve as a modular permeation-enhancing tag for oral peptide delivery.
Why it matters
Oral delivery of therapeutic peptides remains a major pharmaceutical bottleneck. A validated endogenous amphipathic motif derived from an FDA-approved peptide family would have inherent safety credentials and could accelerate oral bioavailability engineering across multiple peptide drug classes.
Plausibility.40
Novelty.60
Impact.65
Basis · grounding3 computed/notes
[1]
sequenceFINWLIQ (positions 25-31) contains W27 as a central aromatic residue flanked by F25, I26, L29, I30, consistent with a hydrophobic face capable of membrane insertion
[2]
structurepLDDT=55 suggests C-terminal disorder, meaning FINWLIQ is not conformationally locked by receptor contact and may be free to interact with membranes
[3]
noteGLP-2 is a gut-lining hormone released luminally and acting on basolateral receptors; its passage through the epithelial environment implies some capacity for membrane interaction
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7875087261199951 openfold3-mlx
ranking score 0.8517722487449646 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.755global PDE — lower = better
disorder0.157fraction disordered
chain pair ipTM (A, B)0.788interface quality
3-letter notation
His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime457s
predicted bymlx@peptide
predicted at2026-04-22
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). GLP-2: natural gut-lining growth hormone (Glucagon-like peptide-2) (pep-10569, v1). PeptideModel. https://peptidemodel.com/card/pep-10569
@peptide{pep10569,
  sequence = {HADGSFSDEMNTILDNLAARDFINWLIQTKITD},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 70 on ct.gov · 6 on EUCTR · checked 2026-05-09
ct.gov trials 70
with results 6
EUCTR 6
PubMed RCT 27
by phase
1phase 21phase 38no phase
by status
5completed2recruiting1active1terminated1unknown
references 8 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use