pe
pep-04439 v1 CC-BY-SA-4.0

Exenatide: Byetta/Bydureon, first approved GLP-1 diabetes drug

Injectable type 2 diabetes treatment derived from Gila monster venom; helps control blood sugar and was the first of its class approved by the FDA in 2005.

statusbioassayed targetGLP-1R length39 aa refs3
fda-approvedglp-1-agonistdiabetesfirst-in-classincretin
snapshot approved 0% confidence
Class
GLP-1 receptor agonist (venom-derived synthetic peptide)
Status
FDA-approved prescription drug (Byetta 2005; Bydureon / Bydureon BCise 2012 / 2017); EMA, MHRA, Health Canada, TGA authorized
Best-supported effect
HbA1c reduction 0.8–1.9 percentage points and modest weight loss (~3–5 kg) in adults with type 2 diabetes, across Phase III trials and 15+ years of post-marketing data (human — approved label)
Main caveat
No FDA weight-management indication; EXSCEL cardiovascular outcomes trial neutral for MACE superiority (unlike liraglutide, semaglutide, dulaglutide); largely displaced by semaglutide, tirzepatide, and dulaglutide in current new-start clinical practice
status 5 / 5 · 2 contributors
prediction metrics boltz-2 1.0
ipTM0.855
pTM0.786
avg pLDDT72.4
ranking score0.751
STRUCTURE · PEP-04439 × GLP-1R
ranking0.751
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence39 aa
1510152025303539
HGEGTFTSDLSKQ MEEEAVRLFIEWL KNGGPSSGAPPPS
in the news 218 articles
overview readme

What this is

Exenatide (sold as Byetta and Bydureon / Bydureon BCise) is an injectable medicine for type 2 diabetes and the first GLP-1 receptor agonist ever approved for human use. It was developed from exendin-4, a compound originally isolated from the salivary glands of the Gila monster (Heloderma suspectum), a venomous lizard native to the American Southwest and northern Mexico — though the drug itself is manufactured by solid-phase peptide synthesis, not extracted from lizards.

Exenatide shares approximately 53% sequence homology with human GLP-1 and carries a glycine at position 2 instead of alanine. That single difference prevents the enzyme dipeptidyl peptidase-4 (DPP-4) from rapidly inactivating it — a resistance that native GLP-1 lacks. Two formulations exist: Byetta (short-acting, twice-daily subcutaneous injection) and Bydureon / Bydureon BCise (extended-release, once-weekly microsphere depot). As the first-in-class GLP-1 agonist, exenatide established proof of concept for the whole drug class, but it has since been largely superseded in new prescriptions by agents with greater efficacy and stronger cardiovascular outcomes data.


History

In the early 1990s, endocrinologist John Eng, working at the Bronx Veterans Affairs Medical Center, isolated a peptide from Gila monster venom that mimicked human GLP-1 but resisted enzymatic breakdown. Eng reasoned that a lizard eating infrequently would need pancreatic peptides with prolonged activity — and confirmed that the isolate, which he named exendin-4, carried glycine rather than alanine at position 2, blocking DPP-4 cleavage (Parkes and colleagues 2013). This insight would underpin the entire GLP-1 drug class. Amylin Pharmaceuticals licensed exendin-4 and partnered with Eli Lilly for development. In April 2005 the FDA approved exenatide as Byetta for type 2 diabetes — the first GLP-1 receptor agonist marketed for human use. An extended-release microsphere formulation, Bydureon, was approved in 2012, followed by the prefilled-autoinjector Bydureon BCise in 2017, reducing dosing from twice-daily to once-weekly.


What it does

Exenatide mimics the gut hormone GLP-1, which is normally released after eating. By activating the GLP-1 receptor on pancreatic beta cells, it stimulates insulin secretion in a glucose-dependent manner and suppresses glucagon release — meaning it only amplifies insulin output when blood sugar is actually elevated, which limits the risk of hypoglycemia during monotherapy. It also slows gastric emptying (blunting post-meal glucose spikes) and signals satiety to the brain, which contributes to weight reduction. In adults with type 2 diabetes, clinical trials from the DURATION program established HbA1c reductions of 0.8–1.9 percentage points and modest weight loss of approximately 3–5 kg (Parkes and colleagues 2013; Kayaniyil and colleagues 2016).


Evidence

  • Human: Extensive. Multiple Phase III trials (the DURATION series), FDA approval since 2005, and more than 15 years of post-marketing data establish HbA1c reductions of 0.8–1.9 percentage points and modest weight loss (~3–5 kg) in adults with type 2 diabetes. The EXSCEL cardiovascular outcomes trial (n=14,752, median 3.2 years) met non-inferiority to placebo for major adverse cardiovascular events (MACE) but did not reach statistical superiority — a neutral result that contrasts with the positive cardiovascular signals reported for liraglutide (LEADER), semaglutide (SUSTAIN-6, SELECT), and dulaglutide (REWIND). Directional signals on all-cause mortality and heart-failure hospitalization trended favorably in EXSCEL. A 6-year open-label extension of DURATION-1 confirmed continued tolerability and sustained glycemic effect with once-weekly exenatide (Kayaniyil and colleagues 2016). Network meta-analyses confirm that exenatide produces meaningfully less weight loss than semaglutide or tirzepatide (Kayaniyil and colleagues 2016). Bydureon BCise carries a pediatric indication (age 10+), though long-term efficacy and safety data in pediatric type 2 diabetes are thinner than the adult evidence base.
  • Animal: Exendin-4 biology and GLP-1R pharmacology are comprehensively characterized in rodent and non-human primate models. Rodent C-cell tumor findings at supratherapeutic doses underpin the class boxed warning.
  • In vitro: GLP-1 receptor binding, downstream cAMP/PKA signaling, DPP-4 resistance mechanism, and microsphere release pharmacology are well-characterized.

Known effects

  • Glycemic control (HbA1c reduction) in type 2 diabetes — FDA-approved; extensively characterized across DURATION trials and post-marketing data
  • Modest weight reduction (~3–5 kg) — Human Phase III data; not an FDA-labeled primary indication
  • Postprandial glucose blunting — Established; consequence of delayed gastric emptying and glucose-dependent insulin potentiation
  • Cardiovascular non-inferiority — EXSCEL met non-inferiority; superiority not demonstrated; class-level CV superiority is not an established effect for exenatide specifically
  • GLP-1 class effects (cognition, Parkinson's disease) — Class-level exploratory signals in meta-analyses; exenatide-specific human data not separately extracted

Safety signals

Nausea is the most common adverse event and is consistent across the GLP-1 class, generally attenuating over time. Vomiting and diarrhea are also common at initiation. Injection-site nodules are characteristic of the Bydureon microsphere formulation and are generally non-serious but persistent.

The class carries a boxed warning for thyroid C-cell tumors based on rodent findings at supratherapeutic doses; human relevance is debated, but the warning is an absolute contraindication in patients with personal or family history of medullary thyroid carcinoma (MTC) or Multiple Endocrine Neoplasia syndrome type 2 (MEN2). Acute pancreatitis has been reported post-marketing; patients with a history of severe or recurrent pancreatitis should not use exenatide. Hypoglycemia risk is elevated when exenatide is combined with insulin or sulfonylureas but is not an intrinsic risk in monotherapy, owing to glucose-dependent insulin secretion.

Exenatide is renally cleared and is not recommended in severe renal impairment (eGFR <30 mL/min/1.73m²); acute kidney injury has been reported post-marketing. Delayed gastric emptying is clinically relevant for co-administered narrow-therapeutic-index oral drugs: INR monitoring is advised with warfarin, and timing matters for oral contraceptives and acute-use oral antibiotics.

The long-term tissue consequences of repeated microsphere deposition with Bydureon have not been rigorously characterized in published literature. Animal reproductive toxicity data and the absence of human safety data support discontinuation in pregnancy; Bydureon's approximately 10-week depot washout is clinically relevant for pre-pregnancy planning.


Regulatory status

  • US (FDA): Prescription-only. Byetta approved April 2005 for type 2 diabetes in adults; Bydureon approved 2012; Bydureon BCise approved 2017 for adults and patients aged ≥10 years. No FDA weight-management indication. Generic exenatide became available following patent expiration; the compounding pathway has narrowed as generics are now commercially available.
  • EU (EMA): Authorized for type 2 diabetes.
  • UK (MHRA): Authorized for type 2 diabetes.
  • Canada (Health Canada): Authorized for type 2 diabetes.
  • Australia (TGA): Authorized; one of the first incretin-class drugs approved globally.
  • WADA: Not specifically named on the current Prohibited List. GLP-1 agonists are under monitoring in weight-category sports; athletes should consult their governing body.

Mechanism

Exenatide is a full agonist at the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed on pancreatic beta cells, gut L-cells, and select neurons. The glycine substitution at position 2 blocks DPP-4 cleavage, extending the half-life from approximately 2 minutes (native GLP-1) to approximately 2.4 hours for Byetta. The Bydureon microsphere depot uses poly(D,L-lactide-co-glycolide) (PLGA) microspheres to sustain therapeutic concentrations over 7 days per weekly injection, with steady-state reached after approximately 6–7 weeks and drug release continuing for approximately 10 weeks after the final injection (Parkes and colleagues 2013).

Upon GLP-1R binding, exenatide activates adenylyl cyclase via Gs proteins, raising intracellular cAMP and activating protein kinase A (PKA). In pancreatic beta cells, this potentiates glucose-dependent insulin secretion and suppresses glucagon release. Glucose-dependence is a key pharmacological feature: GLP-1R agonism does not stimulate insulin secretion in the absence of elevated glucose, which limits hypoglycemia risk in monotherapy. Additional effects include delayed gastric emptying, reducing postprandial glucose excursions, and central satiety signaling contributing to weight reduction.

Semaglutide shares 94% homology with human GLP-1 and achieves extended half-life (~1 week) via fatty-acid modification enabling albumin binding — a mechanistically distinct approach from exenatide's DPP-4-resistance engineering, and one that contributes to semaglutide's substantially greater receptor engagement efficiency and weight-loss efficacy.


Open questions

  • Mechanism behind the neutral EXSCEL cardiovascular result: Whether trial design, patient selection, adherence patterns, or exenatide's pharmacology relative to other GLP-1 agonists explains the absence of MACE superiority — in contrast to liraglutide (LEADER), semaglutide (SUSTAIN-6, SELECT), and dulaglutide (REWIND) — is unresolved. This distinction could illuminate class-level versus molecule-specific cardiovascular mechanisms.
  • Long-term tissue consequences of microsphere depot: Injection-site nodules are common and characteristic with Bydureon. Rigorous long-term characterization of repeated microsphere deposition and associated subcutaneous tissue changes has not been published in the available literature.
  • Direct head-to-head comparisons at equipotent doses: Most comparative efficacy data versus semaglutide, tirzepatide, and dulaglutide come from network meta-analyses rather than directly randomized head-to-head trials at clinically matched exposures (Kayaniyil and colleagues 2016).
  • Pediatric long-term data: Bydureon BCise carries a pediatric indication (age 10+), but the long-term efficacy and safety evidence base in pediatric type 2 diabetes is substantially thinner than the adult evidence base.
  • Optimal current patient population: With semaglutide, tirzepatide, and dulaglutide dominating new prescriptions, the patient populations for whom exenatide remains preferred — beyond cost, access, or tolerability factors — are not well-characterized by prospective data.

Related peptides

  • Liraglutide — once-daily acylated GLP-1 analog (Victoza/Saxenda); 31-residue human GLP-1 backbone; LEADER trial demonstrated MACE superiority; predecessor to semaglutide
  • Semaglutide — 94% homology to human GLP-1; once-weekly via fatty-acid albumin-binding modification; substantially greater weight loss and positive cardiovascular outcomes (SUSTAIN-6, SELECT) vs. exenatide
  • Retatrutide — next-generation triple agonist (GLP-1R/GIPR/GCGR); investigational; substantially greater weight-loss potential than any single GLP-1 agonist
Hypotheses2 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Could the short tail at the end of exenatide change the receptor's active shape and make the signal last longer?

If true, drug developers could add or modify that tail in other GLP-1 medicines to make them work longer or with fewer side effects, potentially helping people with diabetes or obesity take fewer injections.

The hypothesis
The C-terminal extension (residues 30-39, PSSGAPPPS) of exenatide contributes to its prolonged receptor residence time not merely through non-specific contacts, but by stabilizing a distinct GLP-1R active-state conformation that resists arrestin-mediated desensitization compared with native GLP-1.
Why it’s plausible
Exenatide has a 9-residue C-terminal tail absent from native GLP-1. The structure prediction shows a credible GLP-1R complex (ipTM ~0.86, pLDDT 72.4), so the tail likely makes ordered contacts. The tail's proline/serine-rich composition is unusual for a simple membrane anchor; it may therefore encode a specific conformational signal.
Why it matters
If true, the tail would be a modular pharmacology element that could be grafted onto other GLP-1R agonists or engineered to tune signaling bias, rather than just an inert half-life appendage.
Plausibility.70
Novelty.50
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceExenatide sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is 39 aa versus 30-31 aa for native GLP-1; the C-terminal PSSGAPPPS segment is absent from human GLP-1.
[2]
structureBoltz-2 complex prediction ipTM=0.855, pLDDT=72.4 supports an ordered, specific GLP-1R binding mode rather than a disordered tail.
[3]
noteReadme notes exenatide was the first approved GLP-1 agonist and has a longer-acting profile than native GLP-1, consistent with a kinetic or conformational mechanism.
openupdated 2026-06-11

Could the same change that keeps exenatide alive in the bloodstream also shift how strongly it triggers different receptor responses?

If true, chemists could use position 2 to fine-tune new diabetes or obesity drugs for stronger blood-sugar effects and weaker unwanted effects, without inventing entirely new molecules.

The hypothesis
The Gly2 substitution that confers DPP-4 resistance also alters the peptide's local N-terminal conformation in a way that biases GLP-1R signaling toward cAMP production over beta-arrestin recruitment relative to alanine-containing GLP-1 analogs.
Why it’s plausible
Position 2 is alanine in native GLP-1 and glycine in exenatide. The change is small but removes a side-chain methyl group at a site critical for DPP-4 recognition and receptor activation. This single-atom difference could propagate to the receptor's transmembrane signal, not just protease stability.
Why it matters
It would mean DPP-4 resistance and signaling bias can be co-optimized by a single residue, offering a rational design rule for next-generation incretin agonists.
Plausibility.50
Novelty.60
Impact.60
Basis · grounding2 computed/notes
[1]
sequenceExenatide has glycine at position 2 (H-G-E-G...) whereas human GLP-1 has alanine at the equivalent position.
[2]
noteReadme explicitly states the glycine at position 2 prevents DPP-4 from rapidly inactivating exenatide.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8553479909896851 boltz-2
ranking score 0.7506198287010193 boltz-2
structural qualityopenfold3
metricvaluenote
gpde1.042global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Exenatide: Byetta/Bydureon, first approved GLP-1 diabetes drug (pep-04439, v1). PeptideModel. https://peptidemodel.com/card/pep-04439
@peptide{pep04439,
  sequence = {HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 405 on ct.gov · 87 on EUCTR · checked 2026-05-09
ct.gov trials 405
with results 132
EUCTR 87
PubMed RCT 325
by phase
2phase 16phase 32no phase
by status
5completed3terminated2unknown
references 0 papers · 3 non-peer
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use