pe
pep-10691 v1 CC-BY-SA-4.0

GIP (1-39): natural gut hormone that triggers insulin release

A shorter natural form of the gut hormone GIP, which tells the pancreas to release insulin after a meal; the same hormone pathway targeted by the diabetes and weight-loss drug tirzepatide. A natural hormone, not an approved drug itself.

statussynthesized targetGIPR length39 aa refs10
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.745
pTM0.723
avg pLDDT56.0
ranking score0.813
STRUCTURE · PEP-10691 × GIPR
ranking0.813
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence39 aa
1510152025303539
YAEGTFISDYSIA MDKIRQQDFVNWL LAQKGKKSDWKHN
in the news 79 articles
overview readme

What this is

GIP (1-39) is a 39-amino-acid form of the gut hormone GIP (glucose-dependent insulinotropic polypeptide, also called gastric inhibitory polypeptide). GIP is one of the two main incretin hormones — gut-released signals that tell the pancreas to put out more insulin after a meal (Seino 2010). The full-length canonical human hormone is 42 amino acids (Pederson 2016); the 1-39 form characterized by Xie and colleagues (2004) is a shorter natural variant with insulin-releasing activity in its own right. GIP matters today because its receptor, GIPR, is the second target hit by tirzepatide and other dual GLP-1R/GIPR agonists now used for type 2 diabetes and obesity.

History

The hormone that became GIP was first identified through decades of work on "enterogastrones" — gut factors that inhibit stomach acid secretion — and was eventually isolated as a 42-amino-acid polypeptide; Pederson (2016) gives a first-person account of the discovery arc, including the early focus on acid inhibition and the later recognition that the peptide's defining role was glucose-dependent stimulation of insulin release. The receptor (GIPR) was cloned from human tissue by Yamada and colleagues (1995), placing it in the class B (secretin-VIP) family of G-protein-coupled receptors. Usdin and colleagues (1993) mapped GIPR distribution and showed it is expressed widely in peripheral organs and the brain, foreshadowing the non-pancreatic roles (adipose, bone, CNS) that have become central to modern GIP pharmacology. The specific 1-39 form was reported by Xie and colleagues (2004) as a distinct insulinotropic variant of GIP.

What it does

In its core physiological role, GIP is released from K-cells of the duodenum and upper small intestine after a meal and acts on pancreatic β-cells to amplify glucose-stimulated insulin secretion — the classic incretin effect (Seino 2010, Bailey 2024). It is glucose-dependent: GIP only drives insulin release when blood glucose is elevated, which is why it does not cause hypoglycemia on its own. GIP also acts beyond the pancreas — its receptor is present in adipose tissue, bone, and the central nervous system (Usdin 1993), and GIP signaling has been studied in lipid handling, bone turnover, and neuroprotection (Ji 2016). The interplay between GIP and GLP-1 — both signaling through related class B GPCRs that activate cAMP in β-cells — is the basis of the dual-agonist drug class (Seino 2010).

Mechanism

GIPR is a class B G-protein-coupled receptor that couples primarily to Gαs, raising intracellular cAMP in β-cells and other GIPR-expressing tissues; in pancreatic islets this potentiates glucose-triggered insulin secretion (Seino 2010, Yamada 1995). Truncation of GIP at either terminus changes its pharmacology sharply: Hansen and colleagues (2016) showed that N- and C-terminally shortened forms of the naturally occurring amidated truncation GIP(1-30)NH₂ can become high-affinity competitive antagonists rather than agonists at the human GIP receptor, illustrating how a few residues at the N-terminus determine whether the ligand activates the receptor. Species also matters: Sparre-Ulrich and colleagues (2016) demonstrated that (Pro3)GIP — long used as a "GIP receptor antagonist" in rodent work — is in fact a full agonist at the human GIP receptor while behaving as a partial agonist/competitive antagonist in rats and mice, a caveat that reframes how rodent GIP-antagonism literature translates to humans. The stored sequence here is the 39-residue form; the canonical full-length human hormone is 42 amino acids (Pederson 2016), and the active circulating pool in vivo is a mix of full-length and naturally truncated species.

Evidence

  • Human: GIP has been studied in human physiology for decades as one of the two principal incretin hormones; its receptor is the target of approved dual-incretin drugs (tirzepatide) and of investigational GIPR-antagonist conjugates such as AMG 133 (maridebart cafraglutide), which has progressed through phase 1 with weight-loss signals (Véniant 2024).
  • Animal: Long-acting protease-resistant GIP analogs have been developed and tested in rodent models for type 2 diabetes and, separately, for neuroprotection in Alzheimer's-related paradigms (Ji 2016). Species-specific pharmacology of GIP analogs has been characterized in rat, mouse, and human receptor systems (Sparre-Ulrich 2016).
  • In vitro: GIPR pharmacology — agonism, antagonism, and the consequences of N-/C-terminal truncation — has been mapped in transfected cell systems (Hansen 2016, Sparre-Ulrich 2016, Yamada 1995).

Known effects

  • Glucose-dependent insulin secretion — Established physiological role; basis of the incretin concept (Seino 2010).
  • Adipose and bone signaling — GIPR is expressed outside the pancreas; GIP has documented roles in lipid handling and bone turnover (Usdin 1993, Bailey 2024).
  • Neuroprotection (preclinical) — Long-acting GIP analogs cross the blood-brain barrier and show neuroprotective effects in Alzheimer's-related rodent paradigms (Ji 2016).
  • Drug-target validation for obesity/T2D — GIPR is one of the two receptors engaged by tirzepatide and by the bispecific GIPR-antagonist/GLP-1-agonist AMG 133 (Véniant 2024, Bailey 2024).

Regulatory status

GIP (1-39) itself is not an approved drug. The hormone is studied as the endogenous ligand of GIPR; the receptor is the clinical target of approved and investigational therapeutics, not GIP (1-39) as a peptide product.

Related peptides

  • GLP-1 — the other major incretin hormone; GIP and GLP-1 together account for the incretin effect on insulin secretion (Seino 2010). GLP-1 is processed from the proglucagon precursor; the related hormone glucagon shares that precursor.
  • Semaglutide and liraglutide — GLP-1 receptor agonists that engage only the GLP-1 arm of the incretin system, in contrast to dual GIP/GLP-1 agonists.
  • Exenatide — first-in-class GLP-1 receptor agonist; useful contrast to GIP biology.
  • Tirzepatide — dual GIP/GLP-1 receptor agonist; engages GIPR as one of its two targets. AMG 133 (maridebart cafraglutide) takes the opposite approach at GIPR — antagonism rather than agonism — while still agonizing GLP-1R (Véniant 2024).
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could a hormone your gut already makes naturally activate both of the receptors that today's best diabetes and obesity drugs target?

If true, the body's own GIP hormone might weakly activate the GLP-1 receptor as a side effect of their near-identical shapes, which could mean researchers have a simpler natural starting point for designing dual-action drugs, potentially avoiding the complex chemical modifications used in tirzepatide. This matters for anyone hoping for cheaper or cleaner next-generation metabolic medicines.

The hypothesis
GIP(1-39) exhibits measurable cross-reactivity with the GLP-1 receptor at supraphysiological concentrations because the N-terminal YAEGTF hexapeptide of GIP shares the AEGTF motif with GLP-1 (which begins HAEGTF), and the single Y-to-H substitution at position 1 is the primary determinant preventing full GLP-1R engagement rather than divergence across the rest of the sequence.
Why it’s plausible
GIP and GLP-1 both activate class B GPCRs via homologous N-terminal hexapeptides; their receptors share ~44% sequence identity (Sparre-Ulrich 2016, 10.1111/bph.13323). GIP(1-39) starts YAEGTF while GLP-1(7-36) starts HAEGTF - five of the first six residues are identical. Position 1 residue identity (Tyr vs His) is a major receptor selectivity switch for class B peptides. If GLP-1R can accommodate Tyr1 under excess ligand conditions, GIP(1-39) would show partial GLP-1R agonism, making it a natural weak dual-incretin peptide.
Why it matters
Even weak GLP-1R cross-reactivity of native GIP(1-39) would reframe physiological incretin biology and provide a natural template for designing minimal dual GIP/GLP-1 agonists that avoid the large fatty-acid modifications required by tirzepatide.
Plausibility.57
Novelty.37
Impact.50
Basis · grounding2 papers · 1 computed/note
[1]
sequenceGIP(1-39) N-terminus: YAEGTFISDY - positions 2-6 AEGTF are identical to GLP-1 positions 8-12; only Tyr1 vs His7 differs at the critical position
[2]
paper
GIP and GLP-1 receptor sequence identity is ~44%; functional crossreactivity at non-physiological concentrations not ruled out in published studies
doi: 10.1111/bph.13323
[3]
paper
Seino 2010 describes GIP and GLP-1 as acting through related class B GPCRs that both raise islet cAMP; receptor selectivity determinants discussed at the N-terminal peptide level
doi: 10.1111/j.2040-1124.2010.00022.x
openupdated 2026-06-05

Could a hormone released after eating protect brain cells from Alzheimer's-related damage, even in people with perfectly normal blood sugar?

If this holds, GIP(1-39) might reduce the toxic protein tangles and cell death that drive Alzheimer's through a brain pathway that does not depend on glucose at all, meaning it could theoretically help people who do not have diabetes. That would open the door to a simpler, more targeted treatment backbone for a disease that still has very few effective options.

The hypothesis
GIP(1-39) attenuates tau hyperphosphorylation and neuronal apoptosis in neurons expressing human GIPR via a cAMP/PKA pathway that is independent of peripheral glycaemia, making the peptide effective as a neuroprotective agent in Alzheimer's disease even in normoglycaemic subjects.
Why it’s plausible
Ji 2016 (10.1515/revneuro-2015-0021) shows that long-acting GIP analogs cross the blood-brain barrier and reduce Alzheimer's-related pathology in rodent models. Usdin 1993 (10.1210/endo.133.6.8243312) demonstrated that GIPR is widely expressed in brain. The glucose-dependent nature of GIP's insulin-releasing action is a pancreatic-islet-specific property (dependent on KATP channel context); in neurons, cAMP/PKA signaling downstream of GIPR is glucose-independent, so the neuroprotective action should operate in normoglycaemic conditions. GIP(1-39), as a shorter natural variant with intact N-terminus and confirmed insulinotropic activity, likely retains GIPR activation in brain tissue where the full-length C-terminal residues are less critical.
Why it matters
If GIP(1-39) acts neuroprotectively in a glycaemia-independent manner, it represents a simpler backbone than engineered long-acting analogs for CNS-targeted GIPR agonist development, with potentially lower metabolic liability compared to dual GIP/GLP-1 agonists.
Plausibility.50
Novelty.32
Impact.55
Basis · grounding3 papers
[1]
paper
Ji 2016: long-acting GIP analogs reduce Alzheimer's-related tau pathology and neuronal apoptosis in rodent models; GIPR activation in brain neurons is the proposed mechanism
doi: 10.1515/revneuro-2015-0021
[2]
paper
Usdin 1993: GIPR widely expressed in peripheral organs and brain, confirming CNS receptor availability
doi: 10.1210/endo.133.6.8243312
[3]
paper
Xie 2004 confirmed GIP(1-39) retains insulinotropic activity, implying functional GIPR engagement with intact N-terminus
doi: 10.1016/j.regpep.2004.04.013
openupdated 2026-06-05

Could there be a way to make a molecule that grabs the GIP receptor tightly but does not switch it on, giving researchers a precise off-switch tool?

If a small stretch near the middle of GIP is what actually flips the receptor into its active state, scientists could design blockers that occupy the receptor without triggering it. Researchers studying GIP's role in metabolism and weight currently lack reliable human-compatible tools to do this, so such a blocker could unlock years of stalled experiments.

The hypothesis
The WLLAQ stretch (residues 22-26 of the sequence: W-L-L-A-Q) forms an amphipathic helix that inserts into a hydrophobic groove of the GIPR transmembrane bundle, and disrupting this helix by a single Ala substitution at either Trp22 or Leu23 abolishes agonism while preserving high-affinity receptor binding, revealing a separable binding/activation step.
Why it’s plausible
Class B GPCR peptide ligands use a two-step binding mechanism: the C-terminal region docks to the extracellular domain and the N-terminal/middle region engages the transmembrane core to trigger activation (Sparre-Ulrich 2016, 10.1111/bph.13323). In the GIP(1-39) sequence YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, positions 22-26 read WLLAQ. W and two consecutive L residues form the hydrophobic face of a predicted helix, a feature common to activation-competent class B peptides. If this stretch drives TM-core engagement, its disruption should uncouple binding from activation.
Why it matters
Identifying a separable activation element within GIP(1-39) would allow rational engineering of high-affinity silent antagonists, which are urgently needed as research tools (the widely used Pro3-GIP antagonist is species-selective and behaves as a full human agonist per Sparre-Ulrich 2016).
Plausibility.40
Novelty.43
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
sequencePositions 22-26 are WLLAQ: a tryptophan followed by two leucines, constituting a hydrophobic face in a predicted helical segment
[2]
paper
Two-step receptor activation model described for GIPR: ECD docking then TM-core engagement; middle-region hydrophobic residues implicated
doi: 10.1111/bph.13323
[3]
paper
Tyr1 and Phe6 (N-terminal residues) are critical for activation; the study implies additional mid-peptide contacts also govern efficacy
doi: 10.1111/bph.13384
openupdated 2026-06-05

Could the natural GIP hormone be modified to stay active in the body for 24 hours or more, the way the drugs semaglutide and tirzepatide do, without breaking what makes it work?

Native GIP disappears from the bloodstream in about 34 minutes, which makes it impractical as a medicine. If the cluster of lysine building blocks at the far end of GIP can be used as attachment points for a fatty acid, the way approved drugs already use this trick, it might be possible to create a long-acting GIP therapy from the simplest possible natural template, potentially at lower manufacturing complexity and cost than current engineered drugs.

The hypothesis
The two consecutive lysine pairs (K33-K34 and K36, visible in the C-terminal stretch KGKKSDWKHN of the sequence) provide orthogonal handles for site-selective fatty acid conjugation that would extend the half-life of GIP(1-39) from its native ~34 minutes to greater than 24 hours without blocking the N-terminal activation motif, because these lysines are distal from the receptor-engaging N-terminus.
Why it’s plausible
The plasma half-life of native GIP is approximately 34-35 minutes (axis hit, 10.1055/s-2007-1012260), limiting therapeutic utility. Tirzepatide and semaglutide achieve once-weekly dosing via C18/C20 fatty acid conjugation to internal lysines remote from the N-terminus. In GIP(1-39) the sequence KGKKSDWKHN (residues 30-39) contains K30, K33, K34, K36 - four lysine residues in the C-terminal third. These positions are physically remote from the Tyr1-Phe6 N-terminal activation motif. Selective acylation at one of these distal lysines should extend albumin-mediated half-life while preserving receptor activation, providing a simple route to a half-life-extended GIP(1-39) analog without backbone modification.
Why it matters
A half-life-extended GIP(1-39) with preserved agonism would be the simplest possible natural GIP-derived therapeutic backbone, avoiding the synthetic complexity of tirzepatide while retaining the proven GIPR-agonist pharmacology now validated clinically for metabolic disease.
Plausibility.42
Novelty.22
Impact.53
Basis · grounding2 papers · 1 computed/note
[1]
sequenceC-terminal region KGKKSDWKHN contains K30, K33, K34, K36 - four addressable lysines distal from the N-terminal YAEGTF activation motif
[2]
paper
Native GIP plasma half-life is 34-35 minutes (two-compartment PK model), confirming the short half-life problem that acylation would address
doi: 10.1055/s-2007-1012260
[3]
paper
Bailey 2024: duodenal GIP biology and GIPR as drug target reviewed; clinical validation of GIPR-targeting drugs (tirzepatide, AMG 133) confirms the receptor is tractable for engineered peptide therapeutics
doi: 10.1016/j.peptides.2024.171168
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.745458722114563 openfold3-mlx
ranking score 0.8132461905479431 openfold3-mlx
▸structural qualityopenfold3
0
metricvaluenote
gpde0.729global PDE — lower = better
disorder0.145fraction disordered
chain pair ipTM (A, B)0.745interface quality
▸3-letter notation
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime447s
predicted bymlx@peptide
predicted at2026-04-22
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
▸citationbibtex
peptidemodel (2026). GIP (1-39): natural gut hormone that triggers insulin release (pep-10691, v1). PeptideModel. https://peptidemodel.com/card/pep-10691
@peptide{pep10691,
  sequence = {YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 571 on ct.gov · 24 on EUCTR · checked 2026-05-22
ct.gov trials 571
with results 36
EUCTR 24
by phase
1phase 22phase 38no phase
by status
5completed1recruiting1not yet recruiting2unknown
references 10 papers
[6] supporting
[8] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use