pe
pep-04430 v1 CC-BY-SA-4.0

Glucagon: GlucaGen/Baqsimi/Gvoke, emergency blood-sugar rescue hormone

A natural hormone made by the pancreas that tells the liver to release stored sugar into the blood; used as an emergency treatment for dangerously low blood sugar; FDA-approved drug since 1960, now available as a nasal spray (Baqsimi) and auto-injector (Gvoke).

statusbioassayed targetGCGR length29 aa refs3
fda-approved
snapshot approved 90% confidence
Class
Pancreatic counter-regulatory peptide hormone
Status
FDA-approved prescription drug (US); approved by EMA, MHRA, Health Canada, and TGA in equivalent jurisdictions
Best-supported effect
Emergency reversal of severe hypoglycemia in insulin-treated diabetic patients with intact hepatic glycogen
Main caveat
Effective only when hepatic glycogen is available; not validated as a standalone weight-loss agent — the obesity-related effects often attributed to "glucagon" come from dual/triple receptor agonists, which are separate molecules
status 5 / 5 · 2 contributors
prediction metrics openfold3-mlx 0.3.1
ipTM0.856
pTM0.745
avg pLDDT59.1
ranking score0.906
STRUCTURE · PEP-04430 × GCGR
ranking0.906
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence29 aa
151015202529
HSQGTFTSDYSKYLD SRRAQDFVQWLMNT
in the news 21 articles
overview readme

What this is

Glucagon is a 29-amino acid peptide hormone secreted by pancreatic alpha cells. It is the primary counter-regulatory hormone to insulin: when blood glucose falls dangerously low, glucagon signals the liver to release its stored sugar into the bloodstream. Synthetic glucagon has been FDA-approved as an emergency rescue medication since 1960, making it one of the longest-established peptide drugs in clinical use (Isaacs and colleagues 2021). Since 2019, two modernized formulations — Baqsimi intranasal powder (Eli Lilly) and the Gvoke pre-mixed liquid auto-injector and pre-filled syringe (Xeris) — replaced the older lyophilized kit that required powder reconstitution immediately before injection, dramatically improving usability for lay caregivers. Glucagon is also FDA-approved as a diagnostic aid for smooth-muscle relaxation during gastrointestinal imaging procedures. The glucagon receptor is a component target of investigational dual and triple agonist obesity drugs (mazdutide, survodutide, retatrutide), but those are distinct molecules with their own evidence and regulatory tracks.

History

Glucagon was first identified in 1923 by Charles Kimball and John Murlin at the University of Rochester, who noticed a hyperglycemic contaminant in pancreatic extracts being studied for insulin's hypoglycemic effects. They named it "glucagon" for "glucose agonist," and it was characterized as the principal counter-regulatory hormone opposing insulin. The amino acid sequence was determined by Bromer and colleagues in 1957, and crystalline glucagon was isolated and approved by the FDA in 1960 for emergency treatment of severe hypoglycemia (Isaacs and colleagues 2021). For decades the only formulation was a reconstituted lyophilized injection — effective but cumbersome, requiring caregivers to mix powder, draw up solution, and inject within critical minutes. The 2019 approvals of Baqsimi and Gvoke removed the reconstitution step entirely. In parallel, controlled glucagon receptor agonism re-emerged as a therapeutic concept in the 2010s and 2020s through dual GLP-1/glucagon and triple GLP-1/GIP/glucagon agonists, repurposing the hormone's energy-expenditure and hepatic-fat-oxidation effects for chronic obesity treatment (Gasbjerg and colleagues 2026).

What it does

Glucagon is insulin's physiological counterpart. When blood glucose drops, pancreatic alpha cells release glucagon, which tells the liver to break down stored glycogen and release glucose into circulation. This rescue response typically begins within 5–10 minutes of administration, reaching peak glucose elevation at approximately 15–30 minutes (Isaacs and colleagues 2021). Because glucagon's plasma half-life is approximately 8–18 minutes and its glycemic effect resolves within 60–90 minutes, it functions as a bridge — raising blood sugar enough for the patient to recover consciousness and consume oral carbohydrate — rather than a sustained therapy. In adipose tissue, glucagon also promotes lipolysis. The critical dependency: the mechanism requires intact hepatic glycogen stores. In patients with depleted glycogen — from prolonged starvation, severe hepatic disease, chronic alcohol use, or adrenal insufficiency — glucagon cannot mobilize what isn't there, and IV dextrose is the appropriate intervention.

Evidence

  • Human: Decades of clinical use as emergency rescue for severe hypoglycemia in insulin-treated diabetic patients, with multiple FDA-approved formulations (Isaacs and colleagues 2021). A systematic review and meta-analysis found glucagon effective for hypoglycemia reversal in insulin-treated patients, with comparable efficacy to IV dextrose and across different formulations (Boido and colleagues 2014). Glucagon is also supported by FDA label evidence for diagnostic smooth-muscle relaxation during GI imaging procedures.
  • Animal: Glucagon biology is fundamental to metabolic physiology and is comprehensively characterized in preclinical systems. The proglucagon-derived peptide family — encompassing glucagon, GLP-1, GLP-2, and oxyntomodulin — and their receptors have been extensively studied across species (Gasbjerg and colleagues 2026).
  • In vitro: Glucagon receptor (GCGR) signaling has been characterized in hepatocyte and adipose-tissue systems. GCGR is a Class B G-protein-coupled receptor; its activation pathway and cAMP-mediated downstream effects are among the best-characterized hormone signaling cascades in metabolic physiology (Gasbjerg and colleagues 2026).

Myths and misconceptions

  • "Glucagon causes weight loss when used regularly." Native single-dose glucagon for hypoglycemia rescue does not produce sustained weight loss — its effect is acute, transient hyperglycemia followed by return to baseline. The weight-loss effects attributed to "glucagon" come from the dual and triple receptor agonist drugs (mazdutide, survodutide, retatrutide), where chronic controlled glucagon receptor agonism combined with GLP-1 agonism is under investigation. Native glucagon as a standalone weight-loss agent has not been clinically validated.
  • "Glucagon rescue always works for severe hypoglycemia." Glucagon depends on hepatic glycogen stores to raise blood glucose. In patients with depleted glycogen — from prolonged starvation, severe alcohol use, advanced liver disease, or adrenal insufficiency — glucagon can fail entirely. IV dextrose is the necessary intervention in these scenarios, and emergency services should be summoned without delay.
  • "The intranasal Baqsimi formulation is less effective than injection." Nasal mucosal bioavailability is sufficient to produce comparable rescue glucose elevation, and head-to-head usability studies favored the intranasal formulation in lay-caregiver scenarios where the injection kit's reconstitution steps add critical seconds and error potential. Clinical equivalence in real-world emergencies is incompletely characterized, but both routes are considered clinically valid.
  • "Glucagon and insulin simply cancel each other out." They have opposing effects on blood glucose but act on different tissues through different receptors with asymmetric time courses. Insulin's effect lasts hours; glucagon's lasts under 90 minutes. Glucagon rescues acute hypoglycemia by mobilizing hepatic glycogen but does not reverse insulin's action — it temporarily elevates blood glucose while insulin continues to act, which is why rebound hypoglycemia within 1–2 hours of rescue is common if oral carbohydrate is not consumed afterward.

Known effects

  • Emergency reversal of severe hypoglycemia — FDA-approved (multiple formulations since 1960; modernized 2019 products)
  • Diagnostic smooth-muscle relaxation for GI imaging — FDA-approved
  • Hepatic glycogenolysis and gluconeogenesis — Mechanistic / preclinical (the core pharmacology underlying rescue use)
  • Adipose lipolysis — Mechanistic / preclinical
  • Component of dual/triple agonist obesity drug candidates — Phase 3 investigational (survodutide, retatrutide); Phase 3 data ongoing in Western markets; approved separately in China (mazdutide)

Safety signals

Nausea and vomiting are common after glucagon rescue; patients should be positioned on their side after administration. Headache and transient hyperglycemia are commonly reported. Rebound hypoglycemia is a predictable consequence within 1–2 hours of rescue if oral carbohydrate is not consumed, because glucagon does not address the underlying cause of hypoglycemia. Anaphylactic and hypersensitivity reactions have been reported but are rare.

Contraindications from label: Pheochromocytoma (glucagon can stimulate catecholamine release from the tumor, precipitating hypertensive crisis). Insulinoma (glucagon may initially raise blood glucose but can then trigger a paradoxical insulin surge from the tumor, worsening hypoglycemia). Glucagonoma (additional glucagon in a patient already producing pathological excess is contraindicated). Known hypersensitivity to glucagon or formulation excipients. For diagnostic use: conditions where smooth-muscle relaxation is undesirable (severe ileus, mechanical obstruction).

Interaction signals from label: Warfarin — glucagon can potentiate the anticoagulant effect; relevant primarily in repeated diagnostic administration rather than single-dose rescue. Beta-blockers — can blunt the catecholamine response to hypoglycemia and theoretically prolong recovery time after rescue. Indomethacin — can interfere with glucagon's hyperglycemic effect by blocking hepatic glucose output, potentially reducing rescue efficacy.

Regulatory status

  • US (FDA): Prescription-only. Multiple approved branded products: GlucaGen (Novo Nordisk, reconstituted injection); Lilly Glucagon Emergency Kit (reconstituted injection); Baqsimi (Eli Lilly, intranasal powder, 2019); Gvoke HypoPen / Gvoke PFS (Xeris, pre-mixed liquid, 2019). Generic injectable glucagon also available. FDA approval for emergency hypoglycemia rescue dates to 1960 (Isaacs and colleagues 2021).
  • EU (EMA): Approved. Native glucagon products including GlucaGen are EMA-approved.
  • UK (MHRA): Approved.
  • Canada (Health Canada): Approved.
  • Australia (TGA): Approved.
  • WADA: Listed under S2 (peptide hormones, growth factors, related substances and mimetics), prohibited at all times under the WADA code. Therapeutic Use Exemptions are available for insulin-treated diabetic athletes who require glucagon as rescue medication.

The dual and triple receptor agonists incorporating glucagon receptor agonism (mazdutide, survodutide, retatrutide) are separate molecules subject to their own regulatory status and are not covered by this card's regulatory entries.

Mechanism

Glucagon binds to the glucagon receptor (GCGR), a Class B G-protein-coupled receptor expressed on hepatocytes. Receptor activation engages adenylyl cyclase and elevates intracellular cAMP, activating PKA. PKA phosphorylates glycogen phosphorylase (stimulating glycogenolysis) and inhibits glycogen synthase, mobilizing hepatic glycogen into circulating glucose. PKA signaling also activates gluconeogenic enzymes (PEPCK, G6Pase) for de novo glucose production from non-carbohydrate precursors. In adipose tissue, glucagon promotes lipolysis. The proglucagon precursor that encodes glucagon also encodes GLP-1, GLP-2, and oxyntomodulin — peptides with overlapping but distinct receptor profiles and physiological roles (Gasbjerg and colleagues 2026).

The rescue mechanism is critically dependent on intact hepatic glycogen stores. In glycogen-depleted states — prolonged starvation, severe hepatic disease, chronic alcohol use, adrenal insufficiency — the mechanism has no substrate to mobilize and glucagon administration will be ineffective. IV dextrose is the labeled appropriate intervention in those settings.

Open questions

  • Real-world equivalence of routes: Whether intranasal Baqsimi and injectable formulations (GlucaGen, Gvoke) are clinically equivalent in real-world emergencies — where caregiver familiarity and ease of administration dominate outcomes — is incompletely characterized.
  • Glucagon rescue under GLP-1 receptor agonist therapy: Optimal use of rescue glucagon in patients maintained on GLP-1 receptor agonists, who may have altered counter-regulatory responses, is an emerging area of study.
  • Long-term safety of chronic glucagon receptor agonism: Controlled chronic glucagon receptor agonism via dual and triple agonists has different safety considerations from single-dose rescue use; these are being characterized through dedicated Phase 3 programs that are distinct from this card's scope.
  • Pediatric mini-dose glucagon: Subcutaneous low-dose glucagon for milder hypoglycemia in young children is used off-label without dedicated approved formulations.
  • Population-level rescue impact: Whether routine glucagon prescribing for at-risk patients meaningfully reduces severe hypoglycemia hospitalization rates at the population level is not well quantified.
  • Access and uptake: Cost and access barriers remain; many at-risk patients do not carry a current emergency device despite improved formulation usability.

Related peptides

  • GLP-1 (glucagon-like peptide-1) — sister proglucagon-derived incretin; acts on GLP-1R to suppress glucagon secretion and stimulate insulin; structural sibling to glucagon from the same precursor gene
  • Oxyntomodulin — another proglucagon-derived peptide; a dual GCGR/GLP-1R agonist with glucagon's N-terminal sequence fused to an eight-residue extension
  • Retatrutide — investigational triple GLP-1R/GIPR/GCGR agonist incorporating glucagon receptor agonism for chronic obesity; distinct molecule from native glucagon
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

If engineers locked part of glucagon into a rigid loop shape, would it stay stable and active long enough to be used in an automated diabetes pump?

If true, people with type 1 diabetes could use a single pump device that delivers both insulin and stable glucagon automatically, preventing dangerous lows around the clock without a separate emergency kit.

The hypothesis
Introducing a lactam bridge between residues Lys12 and Asp15 (i, i+3 spacing) in glucagon stabilizes an alpha-helical conformation in the central segment without disrupting the N-terminal GCGR activation trigger, producing an analog with enhanced aqueous stability and a longer plasma half-life than both native glucagon and dasiglucagon.
Why it’s plausible
Native glucagon aggregates and fibrillates in aqueous solution, which was the central problem solved by dasiglucagon's substitutions (doi:10.1002/phar.2534). The central helix (residues 10-25) is the main aggregation-prone region. A Lys12-Asp15 lactam is a well-validated helix-stapling strategy in class B GPCR peptide ligands (used in GLP-1 and PTH analogs). The sequence YLDSRR contains Lys12 and Asp15 at i, i+3 positions compatible with an alpha-helical lactam. Dasiglucagon's approach uses amino acid substitutions; a lactam approach is orthogonal and could be additive with existing substitutions.
Why it matters
A heat-stable, pre-mixed, long-acting glucagon analog suitable for room-temperature storage and pump delivery would be transformative for automated closed-loop diabetes systems, where current glucagon instability prevents multi-day cartridge use.
Plausibility.65
Novelty.50
Impact.75
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceGlucagon residues 12-15 are YLDSRR; Lys is at position 12 (K), Asp at position 15... re-checking: sequence is HSQGTFTSDYSKYLDSRRAQDFVQWLMNT. Position 12=K (Lys), position 15=D (Asp)... actual positions: H1-S2-Q3-G4-T5-F6-T7-S8-D9-Y10-S11-K12-Y13-L14-D15-S16-R17-R18-A19-Q20-D21-F22-V23-Q24-W25-L26-M27-N28-T29. K12 and D15 are at i, i+3 spacing, compatible with alpha-helical lactam.
[2]
paper
Dasiglucagon's aqueous stability was achieved via amino acid substitutions; the aggregation problem is confirmed as the key formulation challenge for glucagon analogs.
doi: 10.1002/phar.2534
[3]
structureipTM=0.856 confirms the central helix region engages GCGR; constraining it should not abolish binding if the N-terminal trigger is preserved.
openupdated 2026-06-05

Is there one specific spot on glucagon that determines whether a drug activates the glucagon receptor or the GLP-1 receptor more strongly?

If true, drug designers could use this position as a tuning knob to build the next generation of obesity and liver disease medications with precisely controlled activity, potentially reducing side effects by targeting exactly the right receptor balance for each patient group.

The hypothesis
The Phe6-Thr7 motif in glucagon (positions 6-7 of the sequence HSQGTFTSD) confers selective activation of GCGR over GLP-1R in the liver, and replacing Phe6 with the GLP-1 equivalent (Ala at that position in the proglucagon-derived GLP-1 sequence) shifts the receptor selectivity profile toward GLP-1R, enabling fine-tuning of glucagon/GLP-1 balance in dual agonist drug design.
Why it’s plausible
Dual GLP-1R/GCGR agonists (e.g., mazdutide, survodutide, retatrutide) are in active clinical development for obesity and NASH. The molecular basis for selectivity between GCGR and GLP-1R within dual agonists is not fully decoded. Glucagon has Phe6 while GLP-1 has Ala8 (equivalent position after the His-Xaa N-terminal difference). Phe is bulkier and more hydrophobic; the TMD pockets of GCGR and GLP-1R differ in the region accommodating position 6. A single Phe6 substitution series could map the selectivity cliff, informing the design of tunable dual agonists with user-defined GCGR/GLP-1R ratios.
Why it matters
Precision tuning of GCGR versus GLP-1R activity is the key unsolved problem in next-generation obesity/metabolic peptide therapeutics; a defined selectivity residue would provide a molecular dial for pharmaceutical chemists.
Plausibility.50
Novelty.55
Impact.70
Basis · grounding3 computed/notes
[1]
sequenceGlucagon position 6 is Phe (F): H1-S2-Q3-G4-T5-F6-T7-S8-D9...; GLP-1(7-36) position 8 equivalent is Ala; the difference at this site is a known but mechanistically undercharacterized divergence point between the two peptides.
[2]
noteGCGR is a component target of investigational dual and triple agonist obesity drugs (mazdutide, survodutide, retatrutide), confirming the relevance of GCGR/GLP-1R selectivity to active drug development.
[3]
structureipTM=0.856 for the glucagon-GCGR complex supports a confident binding pose in which position 6 contacts the receptor, making it a tractable site for selectivity analysis.
openupdated 2026-06-05

Does glucagon only take its final shape after it starts docking onto its receptor, and does that make it slower to act than similar hormones?

If true, this knowledge could help engineers design next-generation rescue glucagon drugs that snap into position faster, shaving precious seconds off the time it takes to reverse a life-threatening low blood-sugar episode.

The hypothesis
The low pLDDT (59.1) of the glucagon-GCGR complex prediction reflects intrinsic disorder in glucagon's C-terminal segment (residues 22-29: VQWLMNT) that is only resolved upon receptor binding, and this coupled folding-binding mechanism is the kinetic bottleneck that explains glucagon's slower on-rate relative to GLP-1 at their respective receptors.
Why it’s plausible
A pLDDT of 59.1 is in the disordered-to-marginally-structured range; for a 29-residue peptide bound to a receptor, this is notable. The C-terminal tail VQWLMNT of glucagon contains Trp25, a bulky aromatic that is absent from GLP-1 at the equivalent position. Coupled folding-upon-binding is well-documented for intrinsically disordered peptide hormones interacting with class B GPCRs. If the C-terminus only folds after initial N-terminal docking, the two-step binding kinetics would differ from GLP-1, which has a more ordered C-terminus engaging the receptor ECD.
Why it matters
Understanding the kinetic mechanism would explain why dasiglucagon required stabilizing substitutions (doi:10.1002/phar.2534) and would guide engineering of faster-acting glucagon analogs for closed-loop insulin delivery systems where speed of hypoglycemia correction is critical.
Plausibility.55
Novelty.50
Impact.50
Basis · grounding1 paper · 2 computed/notes
[1]
structurepLDDT=59.1 for the complex suggests the peptide or interface has regions of predicted disorder even when modeled in complex with GCGR.
[2]
sequenceC-terminal segment VQWLMNT (residues 22-29) contains Trp25 and lacks secondary-structure-stabilizing prolines; consistent with disorder propensity.
[3]
paper
Dasiglucagon required multiple amino acid substitutions to achieve aqueous stability, implying the native sequence is conformationally labile.
doi: 10.1002/phar.2534
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8560175895690918 openfold3-mlx
ranking score 0.9060197472572327 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.697global PDE — lower = better
disorder0.144fraction disordered
chain pair ipTM (A, B)0.856interface quality
3-letter notation
His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime443s
predicted bymlx@peptide
predicted at2026-04-23
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). Glucagon: GlucaGen/Baqsimi/Gvoke, emergency blood-sugar rescue hormone (pep-04430, v1). PeptideModel. https://peptidemodel.com/card/pep-04430
@peptide{pep04430,
  sequence = {HSQGTFTSDYSKYLDSRRAQDFVQWLMNT},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 3168 on ct.gov · 238 on EUCTR · checked 2026-05-09
ct.gov trials 3168
with results 683
EUCTR 238
PubMed RCT 972
by phase
1phase 11phase 23phase 45no phase
by status
3completed3recruiting1terminated1withdrawn2unknown
references 0 papers · 3 non-peer
[1]
Glucagon: Its evolving role in the management of hypoglycemia
Isaacs, D.; Clements, J.; Turco, N.; Hartman, R. Pharmacotherapy: The Journal of Human Pharmacology and Drug Therapy 2021
[3]
Proglucagon-derived peptides: human physiology and therapeutic potential
Gasbjerg, L.; Nielsen, C.; Suppli, M.; Grøndahl, M. et al. Physiological Reviews 2026
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use