GIP gut hormone fragment: building block behind tirzepatide (GIP 1-30)
A naturally occurring shorter form of the gut hormone GIP, released after eating to trigger insulin release; studied as a research tool underlying combination obesity treatments like tirzepatide.
- Class
- Gastrointestinal peptide fragment (porcine)
- Status
- No approved therapeutic status identified
- Best-supported effect
- Antibacterial activity is asserted in the source descriptor but is based on a reference concerning GIP (7-42), a distinct fragment; no assay data for this specific form is attached.
- Main caveat
- The source names this peptide GIP (1-30) amide, but the attached sequence contains 36 residues and terminates as a free acid (-OH), not an amide; the chemistry identity is internally inconsistent and requires verification before any further claims can be assessed.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
GIP (1-30) amide, porcine is a 30-residue fragment of gastric inhibitory polypeptide (GIP) — one of the two principal incretin hormones released from the gut after eating. Full-length GIP is a 42-amino acid peptide secreted by K cells in the duodenum and proximal jejunum; the 1-30 fragment arises when the precursor pro-GIP is processed by the enzyme proprotein convertase 2 (PC2) rather than the more common PC1/3, yielding a naturally occurring shorter isoform. The porcine version used here differs from human GIP within the 1-30 stretch at a single residue: position 18 is Arg in the porcine sequence and His in the human sequence. The stored sequence (YAEGTFISDYSIAMDKIRQQDFVNWLLAQK) ends at Lys-30; in the active peptide this C-terminal lysine carries an α-amide group (-NH₂) added by the enzyme peptidylglycine α-amidating monooxygenase (PAM) — that amide is absent from the raw sequence shown here.
History
GIP was first isolated from porcine intestinal extracts in the early 1970s by John Brown, working at the University of British Columbia. Brown initially characterised it as an "enterogastrone" — a gut factor that inhibits gastric acid secretion — and it was named gastric inhibitory polypeptide to reflect that role (Pederson and colleagues 2016; Marks 2020). In 1973, Brown and John Dupré tested a purified porcine GIP preparation in humans and showed it could potentiate glucose-stimulated insulin secretion, establishing GIP's identity as an incretin and prompting a proposed renaming to "glucose-dependent insulinotropic polypeptide" — a name that preserves the GIP acronym while better describing the hormone's principal action (Marks 2020). The 42-residue full-length sequence and the biological importance of C-terminal truncation variants including GIP(1-30) were characterised in subsequent decades, with Morrow and colleagues (1996) providing systematic fragment analysis to map the minimal insulinotropic region.
What it does
GIP (1-30) amide acts as a full agonist at the GIP receptor (GIPR), the same receptor targeted by full-length GIP(1-42), and retains equivalent insulinotropic potency in pancreatic assays (Morrow and colleagues 1996). At the mechanistic level, GIPR belongs to the family of G-protein-coupled receptors; ligand binding activates Gαs, which raises intracellular cyclic AMP in pancreatic β-cells and triggers insulin granule release in a strictly glucose-dependent manner — meaning the hormone only amplifies insulin secretion when blood glucose is already elevated, avoiding hypoglycaemia (Seino and colleagues 2010). Beyond the pancreas, GIPR is expressed widely in peripheral tissues and the brain, including adipose tissue, bone, adrenal cortex, and several brain regions (Usdin and colleagues 1993), and GIP signalling at those sites influences fat storage, bone turnover, and aspects of appetite regulation (Bailey and colleagues 2024). Together with GLP-1, GIP accounts for a substantial portion of the postprandial insulin response in healthy people (Seino and colleagues 2010).
Evidence
- Human: GIP(1-42) as the endogenous hormone has been studied extensively in healthy volunteers and in type 2 diabetes; the GIPR agonist component of tirzepatide (a dual GIP/GLP-1 receptor co-agonist) showed clinically significant weight and glycaemia reduction in Phase III trials (Véniant and colleagues 2024). Direct human data specific to the 1-30 porcine fragment are not available; its role is primarily as a research tool to probe GIP receptor pharmacology.
- Animal: In the isolated perfused rat pancreas, GIP(1-30) retained strong insulinotropic activity comparable to full-length GIP, while showing reduced somatostatinotropic activity in stomach preparations (Morrow and colleagues 1996). In obese diabetic (ob/ob) mice, GIP was identified as the dominant physiological incretin when its receptor was blocked alongside GLP-1R (Gault and colleagues 2003).
- In vitro: N-terminally truncated variants of GIP(1-30)NH₂ — specifically GIP(3-30)NH₂ and GIP(5-30)NH₂ — act as high-affinity competitive antagonists at the human GIPR, establishing GIP(1-30)NH₂ as the agonist reference compound against which these antagonists are characterised (Sparre-Ulrich and colleagues 2016).
Known effects
- Insulin secretion (glucose-dependent) — Full agonist activity at GIPR; equivalent potency to GIP(1-42) in pancreatic assays (Morrow and colleagues 1996)
- GIPR pharmacology reference — Used as the primary agonist control in structure-activity studies of truncated GIP analogs (Sparre-Ulrich and colleagues 2016)
- Somatostatinotropic activity — Reduced relative to full-length GIP; the 1-30 fragment shows preferential pancreatic versus gastric activity (Morrow and colleagues 1996)
Mechanism
GIPR is a class B1 G-protein-coupled receptor (secretin receptor family). GIP(1-30)NH₂ engages the receptor through a two-domain binding model typical of class B peptide hormones: the C-terminal portion of the peptide (residues 19-30 contain the core insulinotropic determinants; Morrow and colleagues 1996) docks at the receptor's extracellular domain, while the N-terminal helix inserts into the transmembrane bundle to activate Gαs. The resulting rise in cAMP activates protein kinase A, which phosphorylates targets in the insulin secretion machinery of pancreatic β-cells (Seino and colleagues 2010). The glucose-dependence of this effect arises from the requirement for prior membrane depolarisation — at fasting glucose levels the β-cell K_ATP channels are insufficiently closed for GIP-driven cAMP to trigger secretion. The C-terminal amide (-NH₂ at Lys-30) is required for full receptor activation; removal of C-terminal residues beyond position 30 progressively converts agonism to antagonism, as demonstrated by the high-affinity antagonist GIP(3-30)NH₂ (Sparre-Ulrich and colleagues 2016). The single residue difference between porcine (Arg-18) and human (His-18) GIP(1-30) can influence species-specific pharmacology: Sparre-Ulrich and colleagues (2016) documented that certain GIP analogs behave differently at rodent versus human GIPR, a point relevant when interpreting results from rat or mouse pancreas preparations using the porcine peptide.
Safety signals
No clinical safety data exist for this specific fragment. As a research-grade peptide used primarily in isolated tissue preparations and in vitro assays, systemic safety profiling in humans has not been reported. The parent hormone GIP(1-42) is an endogenous incretin with a well-characterised physiological role; no adverse safety signal has been attributed to endogenous GIP in the published literature.
Regulatory status
- US: No FDA approval or IND filing. Research reagent only.
- EU: Not authorised. Research reagent only.
- WADA: Not specifically listed. The GIPR-targeting drug class (dual GIP/GLP-1 agonists such as tirzepatide) is under pharmacological surveillance; endogenous GIP fragments are not themselves subject to sport prohibition at present.
Related peptides
GIP (1-30) amide, porcine is closely connected to several peptides in the incretin family:
- GIP full-length (1-42) — the endogenous 42-residue form from which this fragment is derived; shares the same GIPR target and mechanism, and is the parent peptide on which GIP(1-30) fragment analyses are based.
- Tirzepatide — a synthetic dual GIP/GLP-1 receptor co-agonist whose GIPR agonism builds directly on the pharmacology established with reference tools like GIP(1-30)NH₂; the first approved drug to exploit simultaneous GIPR and GLP-1R activation for obesity and type 2 diabetes.
- GLP-1 (7-36) amide — the other major incretin hormone; acts through the structurally related GLP-1 receptor (GLP-1R) and is released from intestinal L cells in coordination with GIP (Seino and colleagues 2010). Both GIP and GLP-1 together account for the majority of the postprandial incretin effect in healthy individuals.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does the shorter version of the GIP gut hormone (residues 1-30) trigger less insulin release than the full version when blood sugar is only just above normal, because it lets go of its receptor more quickly?
If true, this would mean the fragment behaves like a weaker signal under everyday blood-sugar conditions, which matters a lot for scientists designing new diabetes drugs, since a compound that looks strong in a lab test at high sugar could still underperform at the sugar levels real patients actually live at.
Does a single amino-acid difference at position 18, where the pig version has arginine and the human version has histidine, give the pig version a more stable shape and a stronger hold on the GIP receptor?
If this structural difference explains why pig GIP is the preferred research standard, drug designers could deliberately use arginine at that position in new GIP-targeting obesity drugs such as tirzepatide follow-ons, potentially making them more potent.
If you chemically protect the first building block of GIP(1-30) so that a common blood enzyme cannot chop it off, would the peptide last longer and avoid being converted into something that actively blocks the receptor it is supposed to activate?
If it works, this approach could turn GIP(1-30) into a cleaner, longer-lasting research tool, and could also serve as a compact starting template for the next generation of obesity combination therapies, where a shorter peptide is easier to modify and attach to other molecules than the full 42-residue hormone.
Can GIP(1-30), by activating a receptor found in bone tissue, slow down bone breakdown and help rebuild bone density in post-menopausal women, even without touching blood sugar at all?
Osteoporosis affects hundreds of millions of people and current bone-building drugs are expensive, limited in how long they can be used, and not suitable for everyone. If GIP(1-30) could protect bone through a completely different receptor than existing drugs, it might offer a new option that works alongside standard anti-fracture treatments.
Does GIP(1-30) act on hunger-controlling cells in the brain, on its own and independently of the GLP-1 pathway, to reduce food intake?
Tirzepatide already hints that activating the GIP receptor adds weight-loss benefit on top of GLP-1 drugs, but scientists do not yet fully understand how. If GIP(1-30) turns out to have its own direct appetite-suppressing route in the brain, it could become a blueprint for smaller, more targeted drugs that reduce hunger without affecting insulin, potentially useful for people who need appetite control but not diabetes treatment.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.9157397150993347 | boltz-2 |
| ranking score | 0.6721315383911133 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.865 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep10690,
sequence = {YAEGTFISDYSIAMDKIRQQDFVNWLLAQK},
target = {gipr},
author = {peptidemodel},
year = {2026},
status = {synthesized}
}