pe
pep-10690 v1 CC-BY-SA-4.0

GIP gut hormone fragment: building block behind tirzepatide (GIP 1-30)

A naturally occurring shorter form of the gut hormone GIP, released after eating to trigger insulin release; studied as a research tool underlying combination obesity treatments like tirzepatide.

statussynthesized targetGIPR length30 aa refs9
snapshot sparse 15% confidence
Class
Gastrointestinal peptide fragment (porcine)
Status
No approved therapeutic status identified
Best-supported effect
Antibacterial activity is asserted in the source descriptor but is based on a reference concerning GIP (7-42), a distinct fragment; no assay data for this specific form is attached.
Main caveat
The source names this peptide GIP (1-30) amide, but the attached sequence contains 36 residues and terminates as a free acid (-OH), not an amide; the chemistry identity is internally inconsistent and requires verification before any further claims can be assessed.
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.916
pTM0.801
avg pLDDT61.1
ranking score0.672
STRUCTURE · PEP-10690 × GIPR
ranking0.672
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence30 aa
151015202530
YAEGTFISDYSIAMD KIRQQDFVNWLLAQK
in the news 33 articles
overview readme

What this is

GIP (1-30) amide, porcine is a 30-residue fragment of gastric inhibitory polypeptide (GIP) — one of the two principal incretin hormones released from the gut after eating. Full-length GIP is a 42-amino acid peptide secreted by K cells in the duodenum and proximal jejunum; the 1-30 fragment arises when the precursor pro-GIP is processed by the enzyme proprotein convertase 2 (PC2) rather than the more common PC1/3, yielding a naturally occurring shorter isoform. The porcine version used here differs from human GIP within the 1-30 stretch at a single residue: position 18 is Arg in the porcine sequence and His in the human sequence. The stored sequence (YAEGTFISDYSIAMDKIRQQDFVNWLLAQK) ends at Lys-30; in the active peptide this C-terminal lysine carries an α-amide group (-NH₂) added by the enzyme peptidylglycine α-amidating monooxygenase (PAM) — that amide is absent from the raw sequence shown here.

History

GIP was first isolated from porcine intestinal extracts in the early 1970s by John Brown, working at the University of British Columbia. Brown initially characterised it as an "enterogastrone" — a gut factor that inhibits gastric acid secretion — and it was named gastric inhibitory polypeptide to reflect that role (Pederson and colleagues 2016; Marks 2020). In 1973, Brown and John Dupré tested a purified porcine GIP preparation in humans and showed it could potentiate glucose-stimulated insulin secretion, establishing GIP's identity as an incretin and prompting a proposed renaming to "glucose-dependent insulinotropic polypeptide" — a name that preserves the GIP acronym while better describing the hormone's principal action (Marks 2020). The 42-residue full-length sequence and the biological importance of C-terminal truncation variants including GIP(1-30) were characterised in subsequent decades, with Morrow and colleagues (1996) providing systematic fragment analysis to map the minimal insulinotropic region.

What it does

GIP (1-30) amide acts as a full agonist at the GIP receptor (GIPR), the same receptor targeted by full-length GIP(1-42), and retains equivalent insulinotropic potency in pancreatic assays (Morrow and colleagues 1996). At the mechanistic level, GIPR belongs to the family of G-protein-coupled receptors; ligand binding activates Gαs, which raises intracellular cyclic AMP in pancreatic β-cells and triggers insulin granule release in a strictly glucose-dependent manner — meaning the hormone only amplifies insulin secretion when blood glucose is already elevated, avoiding hypoglycaemia (Seino and colleagues 2010). Beyond the pancreas, GIPR is expressed widely in peripheral tissues and the brain, including adipose tissue, bone, adrenal cortex, and several brain regions (Usdin and colleagues 1993), and GIP signalling at those sites influences fat storage, bone turnover, and aspects of appetite regulation (Bailey and colleagues 2024). Together with GLP-1, GIP accounts for a substantial portion of the postprandial insulin response in healthy people (Seino and colleagues 2010).

Evidence

  • Human: GIP(1-42) as the endogenous hormone has been studied extensively in healthy volunteers and in type 2 diabetes; the GIPR agonist component of tirzepatide (a dual GIP/GLP-1 receptor co-agonist) showed clinically significant weight and glycaemia reduction in Phase III trials (Véniant and colleagues 2024). Direct human data specific to the 1-30 porcine fragment are not available; its role is primarily as a research tool to probe GIP receptor pharmacology.
  • Animal: In the isolated perfused rat pancreas, GIP(1-30) retained strong insulinotropic activity comparable to full-length GIP, while showing reduced somatostatinotropic activity in stomach preparations (Morrow and colleagues 1996). In obese diabetic (ob/ob) mice, GIP was identified as the dominant physiological incretin when its receptor was blocked alongside GLP-1R (Gault and colleagues 2003).
  • In vitro: N-terminally truncated variants of GIP(1-30)NH₂ — specifically GIP(3-30)NH₂ and GIP(5-30)NH₂ — act as high-affinity competitive antagonists at the human GIPR, establishing GIP(1-30)NH₂ as the agonist reference compound against which these antagonists are characterised (Sparre-Ulrich and colleagues 2016).

Known effects

  • Insulin secretion (glucose-dependent) — Full agonist activity at GIPR; equivalent potency to GIP(1-42) in pancreatic assays (Morrow and colleagues 1996)
  • GIPR pharmacology reference — Used as the primary agonist control in structure-activity studies of truncated GIP analogs (Sparre-Ulrich and colleagues 2016)
  • Somatostatinotropic activity — Reduced relative to full-length GIP; the 1-30 fragment shows preferential pancreatic versus gastric activity (Morrow and colleagues 1996)

Mechanism

GIPR is a class B1 G-protein-coupled receptor (secretin receptor family). GIP(1-30)NH₂ engages the receptor through a two-domain binding model typical of class B peptide hormones: the C-terminal portion of the peptide (residues 19-30 contain the core insulinotropic determinants; Morrow and colleagues 1996) docks at the receptor's extracellular domain, while the N-terminal helix inserts into the transmembrane bundle to activate Gαs. The resulting rise in cAMP activates protein kinase A, which phosphorylates targets in the insulin secretion machinery of pancreatic β-cells (Seino and colleagues 2010). The glucose-dependence of this effect arises from the requirement for prior membrane depolarisation — at fasting glucose levels the β-cell K_ATP channels are insufficiently closed for GIP-driven cAMP to trigger secretion. The C-terminal amide (-NH₂ at Lys-30) is required for full receptor activation; removal of C-terminal residues beyond position 30 progressively converts agonism to antagonism, as demonstrated by the high-affinity antagonist GIP(3-30)NH₂ (Sparre-Ulrich and colleagues 2016). The single residue difference between porcine (Arg-18) and human (His-18) GIP(1-30) can influence species-specific pharmacology: Sparre-Ulrich and colleagues (2016) documented that certain GIP analogs behave differently at rodent versus human GIPR, a point relevant when interpreting results from rat or mouse pancreas preparations using the porcine peptide.

Safety signals

No clinical safety data exist for this specific fragment. As a research-grade peptide used primarily in isolated tissue preparations and in vitro assays, systemic safety profiling in humans has not been reported. The parent hormone GIP(1-42) is an endogenous incretin with a well-characterised physiological role; no adverse safety signal has been attributed to endogenous GIP in the published literature.

Regulatory status

  • US: No FDA approval or IND filing. Research reagent only.
  • EU: Not authorised. Research reagent only.
  • WADA: Not specifically listed. The GIPR-targeting drug class (dual GIP/GLP-1 agonists such as tirzepatide) is under pharmacological surveillance; endogenous GIP fragments are not themselves subject to sport prohibition at present.

Related peptides

GIP (1-30) amide, porcine is closely connected to several peptides in the incretin family:

  • GIP full-length (1-42) — the endogenous 42-residue form from which this fragment is derived; shares the same GIPR target and mechanism, and is the parent peptide on which GIP(1-30) fragment analyses are based.
  • Tirzepatide — a synthetic dual GIP/GLP-1 receptor co-agonist whose GIPR agonism builds directly on the pharmacology established with reference tools like GIP(1-30)NH₂; the first approved drug to exploit simultaneous GIPR and GLP-1R activation for obesity and type 2 diabetes.
  • GLP-1 (7-36) amide — the other major incretin hormone; acts through the structurally related GLP-1 receptor (GLP-1R) and is released from intestinal L cells in coordination with GIP (Seino and colleagues 2010). Both GIP and GLP-1 together account for the majority of the postprandial incretin effect in healthy individuals.
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does the shorter version of the GIP gut hormone (residues 1-30) trigger less insulin release than the full version when blood sugar is only just above normal, because it lets go of its receptor more quickly?

If true, this would mean the fragment behaves like a weaker signal under everyday blood-sugar conditions, which matters a lot for scientists designing new diabetes drugs, since a compound that looks strong in a lab test at high sugar could still underperform at the sugar levels real patients actually live at.

The hypothesis
The glucose-dependent gating of GIP(1-30)-stimulated insulin secretion is determined not by GIPR-cAMP signaling amplitude but by a KATP channel threshold set by ambient glucose, and at near-threshold glucose concentrations GIP(1-30) is a weaker secretagogue than GIP(1-42) because it lacks the residues 31-42 that allosterically prolong receptor activation.
Why it’s plausible
The readme describes glucose-dependence arising from the requirement for prior beta-cell membrane depolarization via K_ATP channel closure. GIP(1-42) contains the C-terminal helical segment (residues 31-42) that in other class B GPCR peptides (PTH, VIP) prolongs receptor occupancy and slows dissociation. A shorter dissociation half-life for GIP(1-30) at GIPR would reduce integrated cAMP production per receptor engagement. Near the glucose threshold (6-8 mmol/L), where KATP closure is partial and the system is sensitive to cAMP amplitude, this kinetic difference would manifest as a lower effective insulinotropic potency for GIP(1-30) relative to GIP(1-42). The Morrow 1996 reference reports equivalent potency in fully supraglycemic perfused pancreas, but near-threshold conditions were not examined.
Why it matters
If GIP(1-30) is weaker near the glucose threshold, it would behave as a functionally partial agonist under normoglycemic conditions even while appearing as a full agonist in supraglycemic assays -- a distinction critical for its use as a reference compound and for analog design targeting physiological rather than pharmacological glucose ranges.
Plausibility.60
Novelty.64
Impact.59
Basis · grounding2 papers · 1 computed/note
[1]
paper
Morrow 1996 reports equivalent insulinotropic potency to GIP(1-42) in isolated perfused rat pancreas under supraglycemic conditions; near-threshold glucose concentrations not tested
doi: 10.1139/cjpp-74-1-65
[2]
noteGlucose-dependence mechanistically tied to K_ATP closure threshold; cAMP amplitude determines secretory response above threshold
[3]
paper
Both GIP and GLP-1 potency are glucose-dependent; cAMP dose-response interaction with membrane depolarization state discussed
doi: 10.1007/s00125-002-1028-x
openupdated 2026-06-05

Does a single amino-acid difference at position 18, where the pig version has arginine and the human version has histidine, give the pig version a more stable shape and a stronger hold on the GIP receptor?

If this structural difference explains why pig GIP is the preferred research standard, drug designers could deliberately use arginine at that position in new GIP-targeting obesity drugs such as tirzepatide follow-ons, potentially making them more potent.

The hypothesis
The Arg-18 residue in the porcine sequence (versus His-18 in human GIP) sterically stabilizes an alpha-helical conformation in the mid-region (residues 15-22) of GIP(1-30), resulting in higher intrinsic helical propensity and tighter GIPR extracellular domain engagement than the human variant.
Why it’s plausible
The sequence YAEGTFISDYSIAMDKIRQQDFVNWLLAQK has a mid-region (residues 14-20: MDKIRQQD) that in class B GPCRs docks at the extracellular domain before the N-terminal helix inserts into the transmembrane bundle. Arg has a longer, positively charged side chain with different rotameric preferences versus His (imidazole, charge-state dependent). In the neutral pH environment of the receptor-binding cleft, His-18 would be uncharged, while Arg-18 is permanently positively charged. The Sparre-Ulrich reference documents that species-specific pharmacological differences between porcine and human GIP fragments are real and connected to this position. The Boltz-2 prediction shows high iPTM (0.916) despite low per-residue confidence (avg_pLDDT 61.1), consistent with a disordered free peptide that gains order upon receptor binding, with the mid-region helical segment critical for interface quality.
Why it matters
If Arg-18 confers superior helical stability and receptor affinity, it would explain why the porcine GIP(1-30) is the preferred pharmacological reference compound, and would provide a rationale for incorporating Arg at position 18 in synthetic GIPR agonists such as tirzepatide analogs.
Plausibility.54
Novelty.67
Impact.52
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Species-specific pharmacology of GIP is linked to sequence differences between rodent/porcine and human GIP; Arg vs. His at position 18 is the key divergence in the 1-30 stretch
doi: 10.1111/bph.13323
[2]
structureBoltz-2 iPTM 0.916 with avg_pLDDT 61.1 indicates well-defined interface but intrinsically disordered free peptide, consistent with disorder-to-helix transition upon receptor binding
[3]
sequenceYAEGTFISDYSIAMDKIRQQDFVNWLLAQK - position 18 is R (Arg) in porcine vs. H (His) in human
openupdated 2026-06-05

If you chemically protect the first building block of GIP(1-30) so that a common blood enzyme cannot chop it off, would the peptide last longer and avoid being converted into something that actively blocks the receptor it is supposed to activate?

If it works, this approach could turn GIP(1-30) into a cleaner, longer-lasting research tool, and could also serve as a compact starting template for the next generation of obesity combination therapies, where a shorter peptide is easier to modify and attach to other molecules than the full 42-residue hormone.

The hypothesis
Replacing Tyr-1 with a DPP-IV-resistant N-terminal modification (such as alpha-aminoisobutyric acid or N-methyl-Tyr) in GIP(1-30)NH2 would preserve full GIPR agonism because the key activation determinants reside in residues 19-30, while the 2-fold increase in plasma half-life would translate to a proportionally greater integrated incretin response.
Why it’s plausible
DPP-IV cleaves the His-Ala (or in porcine GIP: Tyr-Ala) dipeptide at positions 1-2, converting GIP(1-42) to inactive GIP(3-42). The same enzyme converts GIP(1-30)NH2 to GIP(3-30)NH2, which the Sparre-Ulrich reference characterizes as a high-affinity competitive antagonist. This means DPP-IV cleavage of GIP(1-30)NH2 not only destroys agonism but actively generates an antagonist. The half-life axis_hit (10.1055/s-2007-1012260) reports a plasma half-life of 34-35 minutes for GIP, but this is determined largely by DPP-IV cleavage of the N-terminus. If position 1 or 2 were modified to resist DPP-IV without disrupting the N-terminal helix insertion, agonism would be preserved and antagonist generation suppressed. The structure prediction (iPTM 0.916) supports that the N-terminal region participates in a well-defined interface.
Why it matters
A DPP-IV-resistant GIP(1-30)NH2 variant would be a cleaner reference compound in pharmacological studies (no in situ conversion to antagonist), and could serve as a minimal-length template for GIPR-specific agonists in combination obesity therapies, where the 30-residue format may be more amenable to lipidation or conjugation than the full 42-residue sequence.
Plausibility.67
Novelty.37
Impact.55
Basis · grounding3 papers · 1 computed/note
[1]
paper
GIP(3-30)NH2 is a high-affinity competitive antagonist; DPP-IV converts agonist GIP(1-30) to antagonist GIP(3-30) in situ
doi: 10.1111/bph.13323
[2]
paper
Plasma half-life of GIP approximately 34-35 minutes, largely determined by DPP-IV N-terminal cleavage
doi: 10.1055/s-2007-1012260
[3]
paper
Core insulinotropic determinants in residues 19-30; N-terminus is activation switch, not potency determinant
doi: 10.1139/cjpp-74-1-65
[4]
structureiPTM 0.916 indicates well-defined receptor interface; N-terminal region contributes to ordered complex despite low free-peptide pLDDT
openupdated 2026-06-05

Can GIP(1-30), by activating a receptor found in bone tissue, slow down bone breakdown and help rebuild bone density in post-menopausal women, even without touching blood sugar at all?

Osteoporosis affects hundreds of millions of people and current bone-building drugs are expensive, limited in how long they can be used, and not suitable for everyone. If GIP(1-30) could protect bone through a completely different receptor than existing drugs, it might offer a new option that works alongside standard anti-fracture treatments.

The hypothesis
GIP(1-30)NH2 porcine, or a human-sequence equivalent, can reduce bone resorption and increase bone mineral density in post-menopausal osteoporosis by activating GIPR on osteoblasts and suppressing osteoclast activity, independent of any glycemic effect.
Why it’s plausible
GIPR is expressed in bone tissue (Usdin 1993), and the axis_hits and molmet 2025 review reference explicitly list bone disorders among the indications amenable to GIPR signal modification. Full-length GIP has been shown to influence bone turnover markers in animal models. GIP(1-30)NH2 retains equivalent GIPR agonism to GIP(1-42) while showing reduced somatostatinotropic (gastric) activity, suggesting a cleaner receptor activation profile. Osteoporosis in post-menopausal women is driven by excess osteoclast activity relative to osteoblast bone formation. If bone GIPR activation promotes osteoblast differentiation and/or inhibits osteoclast activity via cAMP-PKA signaling, GIP(1-30)NH2 would represent a naturally-derived fragment template for non-glycemic bone therapy. The fragment's shorter length is an engineering advantage: it could be lipidated for long-acting subcutaneous dosing without the manufacturing complexity of the 42-residue parent.
Why it matters
Osteoporosis affects over 200 million people globally and is inadequately served by existing anabolics (teriparatide, abaloparatide) due to cost and duration limits. A GIP-derived 30-residue GIPR agonist targeting bone GIPR would occupy a different receptor niche from PTH/PTHrP analogs and could be combined with anti-resorptives, addressing a large unmet need.
Plausibility.47
Novelty.35
Impact.67
Basis · grounding3 papers · 1 computed/note
[1]
paper
GIPR widely distributed in peripheral organs including bone-relevant tissues
doi: 10.1210/endo.133.6.8243312
[2]
paper
GIPR signal modification beneficial for bone disorders in addition to obesity/diabetes
doi: 10.1016/j.peptides.2024.171168
[3]
noteGIP signaling influences bone turnover; GIPR expressed in bone
[4]
paper
GIP described as pleiotropic hormone with benefits outside endocrine pancreas including bone and neurodegenerative disorders
doi: 10.1016/j.molmet.2025.102118
openupdated 2026-06-05

Does GIP(1-30) act on hunger-controlling cells in the brain, on its own and independently of the GLP-1 pathway, to reduce food intake?

Tirzepatide already hints that activating the GIP receptor adds weight-loss benefit on top of GLP-1 drugs, but scientists do not yet fully understand how. If GIP(1-30) turns out to have its own direct appetite-suppressing route in the brain, it could become a blueprint for smaller, more targeted drugs that reduce hunger without affecting insulin, potentially useful for people who need appetite control but not diabetes treatment.

The hypothesis
GIP(1-30)NH2 porcine activates GIPR in hypothalamic neurons controlling energy homeostasis independently of its pancreatic insulinotropic effect, and this central action suppresses food intake via a pathway distinct from GLP-1R signaling.
Why it’s plausible
GIPR is expressed in multiple brain regions including hypothalamus (Usdin 1993). The brain GIPR is anatomically positioned to receive GIP signals through the blood-brain barrier or circumventricular organs. The tirzepatide clinical data demonstrate that dual GIPR/GLP-1R agonism produces greater weight loss than GLP-1R agonism alone, and the additional weight loss attributable to GIPR activation (beyond GLP-1R) implies a GIPR-specific central mechanism. GIP(1-30)NH2 is a full GIPR agonist with well-defined pharmacology; its smaller size (30 vs. 42 residues) may favor brain penetration or circumventricular organ access compared to full-length GIP. The axis_hits for clinical-translation reference GIPR signal modification as relevant to neurodegenerative disorders as well, supporting broader central GIPR biology.
Why it matters
If GIP(1-30) directly suppresses food intake via hypothalamic GIPR, it would be a minimal-length natural fragment that activates the central satiety arm of GIP signaling, providing a template for brain-targeted GIPR agonist fragments that bypass pancreatic effects for pure appetite control.
Plausibility.37
Novelty.40
Impact.55
Basis · grounding3 papers · 1 computed/note
[1]
paper
GIPR is widely distributed in brain including several hypothalamic regions
doi: 10.1210/endo.133.6.8243312
[2]
paper
GIPR antagonist conjugated to GLP-1 analog AMG 133 produces weight loss beyond GLP-1R agonism alone, implying GIPR-specific central weight loss mechanisms
doi: 10.1038/s42255-023-00966-w
[3]
paper
GIPR signal modification relevant to obesity and neurodegenerative disorders beyond pancreas
doi: 10.1016/j.peptides.2024.171168
[4]
noteGIPR expressed in brain; GIP signaling influences aspects of appetite regulation
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.9157397150993347 boltz-2
ranking score 0.6721315383911133 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.865global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). GIP gut hormone fragment: building block behind tirzepatide (GIP 1-30) (pep-10690, v1). PeptideModel. https://peptidemodel.com/card/pep-10690
@peptide{pep10690,
  sequence = {YAEGTFISDYSIAMDKIRQQDFVNWLLAQK},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 15 on ct.gov · checked 2026-05-09
ct.gov trials 15
with results 2
by phase
1phase 12phase 41early phase 16no phase
by status
7completed2unknown
references 9 papers
[2] supporting
[6] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use