GIPR is the second receptor in the dual-agonist obesity story. Tirzepatide (Mounjaro/Zepbound) is a GLP-1R/GIPR dual agonist - the first approved drug targeting both receptors. Retatrutide adds GCGR as a third target.
MariTide (Amgen) is a GIPR antagonist combined with GLP-1R agonism - the opposite approach, suggesting GIPR biology is still debated. Survodutide (Boehringer) is another dual GLP-1R/GCGR agonist.
GIPR is the class B GPCR for glucose-dependent insulinotropic polypeptide (GIP) - the incretin hormone released by duodenal K cells after meals to potentiate glucose-stimulated insulin secretion. GIPR co-activation with GLP-1R is the pharmacological foundation of tirzepatide (Mounjaro/Zepbound), the most effective approved weight loss and diabetes drug to date. GIPR's anabolic and bone-protective effects, central satiety signals, and cardioprotective functions make it far more than just a beta-cell amplifier. Every scaffold targeting incretin biology, obesity, or cardiometabolic disease that moves beyond pure GLP-1R agonism routes through this card.
GIPR (chromosome 19q13.32, 14 exons, 466 aa, ~53 kDa) adopts the canonical class B GPCR architecture: N-terminal extracellular domain (ECD) with three conserved disulfide bonds (Cys46–Cys70, Cys61–Cys103, Cys84–Cys118), seven TM helices, and a C-terminal tail with GRK phosphorylation sites for β-arrestin recruitment. GIP (42 aa, secreted from preproGIP by K cells) binds GIPR with Kd ~2 nM / Ki ~0.8 nM; it is degraded within 2–7 minutes by DPP-4 (cleavage at position 2 Ala). The two-domain binding mechanism of class B GPCRs applies: C-terminal GIP helix engages ECD, N-terminus drives TM activation. Primary signaling: Gs → adenylyl cyclase → cAMP → PKA → CREB → insulin secretion in beta cells, anabolic gene programs in adipose and bone. EPAC and Gβγ contribute parallel signals. β-Arrestin2 drives desensitization and clathrin-mediated internalization. GIPR is highly expressed in beta cells, adipose, adrenal cortex, heart, pituitary, and hippocampus. The rs10423928 A allele impairs insulin secretion and is associated with T2D risk.
Tirzepatide (GIP/GLP-1R dual agonist, 39-aa lipidated peptide) is FDA-approved for T2D and obesity - it outperforms pure GLP-1R agonists on HbA1c reduction and weight loss, in large part through GIPR co-activation. DPP-4 inhibitors (sitagliptin, saxagliptin) indirectly boost GIPR signaling by prolonging endogenous GIP. (Pro³)GIP is the canonical research GIPR antagonist (competitive, Ki ~13 nM in rodents; partial/full agonist at human receptor - a species difference that complicates antagonist translation). For peptide research, the tractable recipes are: tirzepatide-derived single-chain dual agonists with tunable GIPR/GLP-1R selectivity ratios via N-terminal substitutions; DPP-4-resistant GIP analogs (Aib substitution at position 2) for longer-acting monotherapy; GIPR-selective agonists that preserve the anabolic bone effects without full GLP-1R-mediated appetite suppression; and triagonist scaffolds (GIP/GLP-1/glucagon) using tirzepatide as the template for maximum metabolic flexibility.
YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS · 39 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-00017 | Tirzepatide: Mounjaro/Zepbound weight-loss & diabetes drug | pe@peptidemodel | 6 | — | 0 | |
| 2 | pep-10691 | GIP (1-39): natural gut hormone that triggers insulin release | pe@peptidemodel | 10 | — | 0 | |
| 3 | pep-10689 | GIP: natural gut hormone that boosts insulin after meals | pe@peptidemodel | 10 | — | 0 | |
| 4 | pep-10690 | GIP gut hormone fragment: building block behind tirzepatide (GIP 1-30) | pe@peptidemodel | 9 | — | 0 | |
| 5 | pep-10537 | GIP receptor blocker: research tool for studying tirzepatide's gut hormone target (GIP 6-30 amide) | pe@peptidemodel | 9 | — | 0 | |
| 6 | pep-00018 | Retatrutide: LY3437943, triple-action weight-loss drug (GIP/GLP-1/glucagon) | pe@peptidemodel | 5 | — | 1 | |
| 7 | pep-10606 | GIP: gut hormone that boosts insulin after meals (Gastric inhibitory polypeptide) | pe@peptidemodel | 7 | — | 0 | |
| 8 | pep-10692 | GIP gut hormone: pig form used in insulin and obesity research | pe@peptidemodel | 6 | — | 0 | |
| 9 | pep-10771 | GIP: the gut hormone that boosts insulin after eating (full-length form) | pe@peptidemodel | 10 | — | 0 | |
| 10 | pep-10531 | GIP gut-hormone fragment: research tool (GIP 3-42) | pe@peptidemodel | 8 | — | 0 | |
| 11 | pep-10772 | Longer-lasting gut insulin signal (GIP Pro3 analog) | pe@peptidemodel | 7 | — | 0 | |
| 12 | pep-10906 | CT-388: experimental obesity & type 2 diabetes drug (Roche/Genentech) | pe@peptidemodel | 2 | — | 0 | |
| 13 | pep-10902 | MariTide (AMG 133): Amgen's monthly obesity & diabetes injection | pe@peptidemodel | 2 | — | 0 | |
| 14 | pep-10903 | Ecnoglutide (HRS9531): once-weekly weight-loss & diabetes injection | pe@peptidemodel | 1 | — | 0 |
No discussion threads yet.