secretin receptor family (class B GPCR) · human

GIPR

GIP receptor
gastric inhibitory polypeptide receptor · UniProt P48546 · gene GIPR
weight loss diabetes

GIPR is the second receptor in the dual-agonist obesity story. Tirzepatide (Mounjaro/Zepbound) is a GLP-1R/GIPR dual agonist - the first approved drug targeting both receptors. Retatrutide adds GCGR as a third target.

MariTide (Amgen) is a GIPR antagonist combined with GLP-1R agonism - the opposite approach, suggesting GIPR biology is still debated. Survodutide (Boehringer) is another dual GLP-1R/GCGR agonist.

browse 14 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Tirzepatide: Mounjaro/Zepbound weight-loss & diabetes drug

YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS · 39 aa · @peptidemodel

bioassayed pep-00017 @peptidemodel refs: 6

all cards · 14 candidates against GIPR

# id title author status refs ipSAE_d0chn ♥
2 pep-10691 GIP (1-39): natural gut hormone that triggers insulin release pe@peptidemodel
10 — 0
3 pep-10689 GIP: natural gut hormone that boosts insulin after meals pe@peptidemodel
10 — 0
4 pep-10690 GIP gut hormone fragment: building block behind tirzepatide (GIP 1-30) pe@peptidemodel
9 — 0
5 pep-10537 GIP receptor blocker: research tool for studying tirzepatide's gut hormone target (GIP 6-30 amide) pe@peptidemodel
9 — 0
6 pep-00018 Retatrutide: LY3437943, triple-action weight-loss drug (GIP/GLP-1/glucagon) pe@peptidemodel
5 — 1
7 pep-10606 GIP: gut hormone that boosts insulin after meals (Gastric inhibitory polypeptide) pe@peptidemodel
7 — 0
8 pep-10692 GIP gut hormone: pig form used in insulin and obesity research pe@peptidemodel
6 — 0
9 pep-10771 GIP: the gut hormone that boosts insulin after eating (full-length form) pe@peptidemodel
10 — 0
10 pep-10531 GIP gut-hormone fragment: research tool (GIP 3-42) pe@peptidemodel
8 — 0
11 pep-10772 Longer-lasting gut insulin signal (GIP Pro3 analog) pe@peptidemodel
7 — 0
12 pep-10906 CT-388: experimental obesity & type 2 diabetes drug (Roche/Genentech) pe@peptidemodel
2 — 0
13 pep-10902 MariTide (AMG 133): Amgen's monthly obesity & diabetes injection pe@peptidemodel
2 — 0
14 pep-10903 Ecnoglutide (HRS9531): once-weekly weight-loss & diabetes injection pe@peptidemodel
1 — 0
1–14 of 14

target literature · 39 curated papers

[1]
Madsbad, Sten et al. 2025 Expert Opinion on Investigational Drugs The promise of glucagon-like peptide 1 receptor agonists (GLP-1RA) for the treatment of obesity: a look at phase 2 and 3 pipelines
cited by
5
cards
[2]
Gasbjerg, Lærke S. et al. 2026 Physiological Reviews Proglucagon-derived peptides: human physiology and therapeutic potential
cited by
2
cards
[3]
Choueiri, Toni K. et al. 2024 Nature Medicine Author Correction: Targeting the HIF2–VEGF axis in renal cell carcinoma
cited by
1
cards
[4]
Drucker, D. et al. 2014 Annual Review of Physiology Physiology and Pharmacology of the Enteroendocrine Hormone Glucagon-Like Peptide-2
cited by
1
cards
[6]
Chen, R. 2025 Transactions on Materials, Biotechnology and Life Sciences Semaglutide as a Novel Therapeutic Agent for Obesity and Type 2 Diabetes
cited by
1
cards
[7]
Müller, T. et al. 2025 Molecular Metabolism Glucose-dependent insulinotropic polypeptide (GIP)
cited by
3
cards
[8]
Schally, A. et al. 2025 npj Aging A 50-year journey in the development of treatment for benign prostatic hyperplasia
cited by
1
cards
[9]
Naga Lakshmi A et al. 2025 Journal of Pharma Insights and Research Pharmacology and Clinical Efficacy of Semaglutide in the Management of Type 2 Diabetes Mellitus
cited by
1
cards
recent news 5 articles

discussion · 0 threads

No discussion threads yet.