pe
pep-10531 v1 CC-BY-SA-4.0

GIP gut-hormone fragment: research tool (GIP 3-42)

A naturally occurring fragment of GIP, a gut hormone released after eating that helps regulate insulin and metabolism; used only as a lab research tool to study the GIP receptor.

statusbioassayed targetGIPR length40 aa refs8
status 4 / 5 · 2 verified on platform
prediction metrics openfold3-mlx 0.3.1
ipTM0.702
pTM0.694
avg pLDDT53.8
ranking score0.786
STRUCTURE · PEP-10531 × GIPR
ranking0.786
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence40 aa
1510152025303540
EGTFISDYSIAMDKIHQQDF VNWLLAQKGKKNDWKHNITQ
in the news 61 articles
overview readme

What this is

GIP (3-42) is a naturally occurring fragment of gastric inhibitory polypeptide (GIP), a gut hormone released after eating that helps regulate insulin secretion and metabolism. The full-length GIP hormone is 42 amino acids long; GIP (3-42) corresponds to positions 3 through 42, lacking the first two residues (tyrosine and alanine) present in intact GIP. The stored 40-residue sequence (EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ) begins at the glutamic acid that opens position 3 of the parent hormone. This truncated fragment retains the ability to bind the GIP receptor (GIPR) and is used as a research tool to probe GIP receptor signaling and pharmacology.

History

GIP was first identified in the late 1960s and early 1970s through efforts to isolate acid-inhibitory factors — substances thought to suppress gastric acid secretion after a meal. These candidate substances were historically called "enterogastrones." The work ultimately led to the isolation of GIP as a 42-amino-acid polypeptide (Pederson and colleagues 2016; Marks 2020). Over subsequent decades, the focus of GIP research shifted from gastric acid inhibition toward its role as an incretin — a hormone that amplifies glucose-stimulated insulin secretion from pancreatic beta cells (Seino and colleagues 2010). The N-terminally truncated fragment GIP (3-42) emerged as a pharmacological tool for studying GIPR binding and receptor activity, particularly as interest in the GIP system grew in parallel with the development of dual incretin therapies.

What it does

GIP (3-42) binds to the GIP receptor (GIPR), a class B G-protein-coupled receptor (GPCR) that is widely distributed across peripheral organs and the brain (Usdin and colleagues 1993). In the context of the intact GIP system, GIPR activation in pancreatic beta cells triggers an increase in intracellular cyclic AMP (cAMP), potentiating glucose-stimulated insulin secretion — the classic incretin effect (Seino and colleagues 2010). GIP (3-42) retains GIPR binding activity and is used experimentally to investigate receptor occupancy and competition at the GIPR. Because it lacks the first two residues of full-length GIP, its intrinsic functional activity at the receptor may differ from the intact hormone, though the dossier sources do not report specific binding affinity values for this fragment.

Evidence

  • Human: No published clinical data on GIP (3-42) specifically.
  • Animal: GIP (3-42) has been studied as a GIPR pharmacology tool; species differences in GIPR ligand behavior are documented in the literature — for example, compounds with altered N-termini show distinct agonist or antagonist profiles depending on whether they are tested at rodent versus human GIP receptors (Sparre-Ulrich and colleagues 2016).
  • In vitro: GIPR is a well-characterized class B GPCR; receptor binding and cAMP signaling assays have been used to profile GIP variants and fragments in cell-based systems (Seino and colleagues 2010; Usdin and colleagues 1993).

Mechanism

GIPR belongs to the secretin-vasoactive intestinal peptide receptor family within the class B GPCR superfamily (Usdin and colleagues 1993). Binding of GIP peptides to GIPR activates adenylyl cyclase via Gαs, raising intracellular cAMP in target cells including pancreatic beta cells, adipocytes, and neurons (Seino and colleagues 2010). GIP (3-42) retains the receptor-binding domain of the parent hormone; the significance of the missing N-terminal dipeptide (Tyr-Ala) for signaling efficacy is an active area of pharmacological study. Notably, research on GIPR ligands has revealed meaningful interspecies differences: the truncated or substituted analogs can behave as full agonists at human GIPR while acting as partial agonists or competitive antagonists at rodent GIPR, complicating the translation of murine pharmacology studies to human predictions (Sparre-Ulrich and colleagues 2016).

Known effects

  • GIPR binding — Retains binding at the GIP receptor (GIPR); used as a receptor pharmacology research tool
  • Incretin pathway engagement — Parent GIP hormone activates cAMP signaling in beta cells, potentiating glucose-stimulated insulin secretion; fragment activity depends on pharmacological context (Seino and colleagues 2010)
  • Research context — dual agonist strategy — The GIPR is the target of tirzepatide's GIP agonism arm; GIP (3-42) is used to investigate receptor occupancy and competitive binding in this context (Bailey and colleagues 2024)

Regulatory status

  • US: Not approved by the FDA. Research use only.
  • EU: Not approved. Research use only.
  • WADA: Not listed as a prohibited substance in the current prohibited list.

Related peptides

GIP (3-42) is directly derived from the full 42-amino-acid GIP hormone and is studied within the broader GIP/GLP-1 incretin axis. Related cards on this platform include:

  • Full-length GIP (GIP 1-42) — the parent hormone from which this fragment is derived; see also the GIPR target entry.
  • Tirzepatide (/card/pep-00018) — a dual GIP/GLP-1 receptor agonist approved for type 2 diabetes and obesity; GIPR agonism is one half of its mechanism, making GIP pharmacology directly relevant to understanding tirzepatide's profile.
  • GLP-1 — the other primary incretin hormone; GIP and GLP-1 share incretin function and their receptors are both class B GPCRs (Seino and colleagues 2010).
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

If we chemically lock the most active helical part of GIP(3-42) into its receptor-binding shape, would it resist breakdown and act for longer?

A version of GIP(3-42) that survives longer in the blood could give researchers a steadier tool to study GIP signaling in animals without constant re-dosing, and could seed new compounds that dial down GIP receptor activity. This is a proposed engineering approach, not yet demonstrated for this fragment.

The hypothesis
Stapling or cyclizing the central alpha-helical segment of GIP(3-42) (approximately MDKIHQQDFVNWLLAQK, positions 13-29 of the fragment) would stabilize the receptor-binding conformation and produce a protease-resistant GIPR antagonist with prolonged plasma half-life compared to the linear fragment.
Why it’s plausible
GIP(3-42) is rapidly cleared in vivo partly because the linear peptide is susceptible to proteolytic degradation and renal clearance. The central hydrophobic-basic helix (DFVNWLLAQKGKK) is the probable receptor-contact pharmacophore. Hydrocarbon stapling of this region at i, i+4 positions (e.g., WLLAQK span) would lock the helical conformation, resist proteases, and potentially increase receptor residence time. This approach has succeeded for other class B GPCR peptide ligands including GLP-1 analogues.
Why it matters
If a stapled GIP(3-42) analogue retains GIPR antagonism with longer half-life, it becomes a viable pharmacological tool for in vivo GIPR blockade studies that currently require continuous infusion of the linear peptide, and a starting point for therapeutic GIPR modulators.
Plausibility.60
Novelty.55
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceSequence DFVNWLLAQKGKKNDWKH (positions 22-39) contains leucine-leucine-alanine-glutamine-lysine repeat consistent with a 3.5 residue/turn amphipathic helix suitable for stapling at i,i+4 or i,i+7 positions
[2]
structureipTM=0.70 indicates moderate GIPR interface, suggesting the binding surface is partially but not optimally formed; constraining the helix could improve ipTM and binding affinity
[3]
paper
GIPR pharmacology study providing context for the biological relevance of stable GIPR antagonists as research tools
doi: 10.1111/bph.13323
openupdated 2026-06-11

Does removing the first two amino acids of GIP turn it from a full activator into one that may trigger only part of the receptor's downstream signals, rather than a pure blocker?

GIP(3-42) is usually treated as a clean GIP receptor blocker. If it instead sent partial signals, some experiments that used it to switch off GIP signaling might need re-checking, and it could inform the design of selective GIP receptor drugs for obesity. This is a proposed idea, not an established finding.

The hypothesis
GIP(3-42) acts as a biased GIPR ligand that retains receptor binding but selectively uncouples Gs-cAMP signaling from beta-arrestin recruitment, making it a partial agonist rather than a neutral antagonist at the GIP receptor.
Why it’s plausible
The ipTM of 0.70 indicates moderate predicted interface quality with GIPR, consistent with binding but not full activation geometry. The N-terminal Y1-A2 dipeptide of intact GIP is critical for receptor activation in class B GPCRs, where the N-terminus inserts into the transmembrane bundle to trigger Gs coupling. Loss of Y1-A2 likely leaves the extracellular domain interaction (ECD, via the mid-fragment core FISDYSIAMDKIH) largely intact while perturbing the activation trigger, producing biased signaling.
Why it matters
If GIP(3-42) is truly biased rather than a pure antagonist, published pharmacological studies using it to 'block' GIPR may have misattributed beta-arrestin-mediated effects to residual GIP activity, altering conclusions about GIPR biology and the design of GIPR-targeting obesity drugs.
Plausibility.55
Novelty.55
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
structureipTM=0.70, pLDDT=53.8 for GIP(3-42)/GIPR complex; moderate interface score suggests binding without full activation-competent conformation
[2]
sequenceSequence EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ lacks Y1-A2 dipeptide present in full GIP; class B GPCR activation requires N-terminal peptide insertion into transmembrane core
[3]
paper
GIPR pharmacology and signaling study; receptor coupling context
doi: 10.1111/bph.13323
openupdated 2026-06-11

If GIP(3-42) occupies the GIP receptor without fully switching it on, could it slow the receptor shutdown that can make some gut-hormone drugs less effective over time?

Some patients on incretin-based obesity drugs see diminishing returns over months. A molecule that helped preserve receptor sensitivity could, in principle, keep these drugs working longer. This is an untested hypothesis that assumes GIP(3-42) acts as a partial blocker.

The hypothesis
GIP(3-42), by occupying the GIPR without fully activating it, could reduce the receptor desensitization and downregulation that limits the effectiveness of therapeutic GIPR agonists over time, making it a candidate adjunct to prevent tachyphylaxis in dual GIP/GLP-1 therapies.
Why it’s plausible
Sustained GIPR agonism in obesity therapy can trigger receptor internalization and downregulation, blunting long-term efficacy. A partial agonist or biased ligand occupying GIPR could competitively limit full agonist-driven internalization when dosed intermittently. The N-terminal truncation removes the activation trigger while the mid-sequence DFVNWLLAQKGKK region (positions 22-34) likely sustains receptor occupancy through ECD contacts, positioning GIP(3-42) for receptor-sparing competition.
Why it matters
Tachyphylaxis to incretin therapies is a clinically observed problem. If GIP(3-42) or an engineered analogue could periodically 'reset' receptor availability, it would extend the therapeutic window of tirzepatide-class drugs, which represent multi-billion dollar treatments for obesity and T2D.
Plausibility.45
Novelty.60
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceSequence contains DFVNWLLAQKGKKNDWKH (positions 22-39 of fragment), a hydrophobic and basic stretch predicted to anchor to GIPR ECD independent of the activating N-terminal segment
[2]
paper
GIP/GIPR biology; discusses receptor expression, K-cell secretion, and pharmacological regulation of the GIP axis relevant to receptor desensitization context
doi: 10.2337/db09-0035
[3]
noteReadme confirms GIP(3-42) emerged as a tool during development of dual incretin therapies, placing it directly in the therapeutic context
openupdated 2026-06-11

Beyond blood sugar, could this gut-hormone fragment also affect the bone breakdown that contributes to osteoporosis, since bone cells carry GIP receptors?

If GIP(3-42) influenced bone without triggering the full insulin response, it could point toward separating GIP's bone effects from its metabolic ones, which matters for people with diabetes who face higher fracture risk. This is a speculative repurposing idea that assumes the fragment acts as a partial agonist in bone.

The hypothesis
GIP(3-42) may attenuate osteoclast activity and bone resorption independently of its metabolic effects by acting as a partial GIPR agonist in bone, given that GIPR is expressed on osteoblasts and osteoclasts and intact GIP is a known bone-anabolic signal.
Why it’s plausible
Full-length GIP has established anti-resorptive effects in bone via GIPR expressed on osteoclasts. If GIP(3-42) acts as a partial agonist, it could partially mimic the bone-protective effect of intact GIP while avoiding the full pancreatic insulin-secretory response, providing a dissociated bone-metabolic pharmacology. The C-terminal region KGKKNDWKHNITQ (residues 28-40) is shared with intact GIP and may mediate bone-cell GIPR contacts distinct from the pancreatic signaling pathway.
Why it matters
Dual incretin therapies like tirzepatide have raised questions about whether GIPR modulation affects bone density. If GIP(3-42) exerts partial bone protection, it could be developed as a research tool or lead compound for osteoporosis, distinct from its original metabolic context.
Plausibility.45
Novelty.60
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceC-terminal KGKKNDWKHNITQ of GIP(3-42) is identical to intact GIP residues 30-42, a region implicated in bone-cell GIPR engagement in prior structure-activity studies of GIP analogues
[2]
paper
GIP/GIPR biology review; covers extra-pancreatic GIPR expression including bone, supporting plausibility of GIPR-mediated bone effects for this fragment
doi: 10.2337/db09-0035
[3]
noteReadme contextualizes GIP(3-42) as a pharmacological research tool specifically for receptor binding and activity studies, implying it retains meaningful receptor contact across tissues
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7024029493331909 openfold3-mlx
ranking score 0.785611093044281 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.801global PDE — lower = better
disorder0.170fraction disordered
chain pair ipTM (A, B)0.702interface quality
3-letter notation
Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime450s
predicted bymlx@peptide
predicted at2026-04-22
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). GIP gut-hormone fragment: research tool (GIP 3-42) (pep-10531, v1). PeptideModel. https://peptidemodel.com/card/pep-10531
@peptide{pep10531,
  sequence = {EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 177 on ct.gov · checked 2026-05-09
ct.gov trials 177
with results 11
PubMed RCT 8
by phase
1phase 11phase 28no phase
by status
7completed2recruiting1active
references 8 papers
[4] supporting
[7] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use