Liraglutide: Victoza/Saxenda daily injection for diabetes & weight loss
A lab-made version of a natural gut hormone that tells the brain you're full, lowers blood sugar, and reduces the risk of heart attack and stroke; FDA-approved drug.
- Class
- GLP-1 receptor agonist
- Status
- FDA-approved prescription drug (Victoza for type 2 diabetes, January 2010; Saxenda for chronic weight management, December 2014; Saxenda adolescent indication, 2020); generic versions available in US from 2024 (Victoza) and 2025 (Saxenda); also authorized by EMA, MHRA, Health Canada, and TGA
- Best-supported effect
- ~8% mean body-weight reduction at 56 weeks in adults with obesity (SCALE program, n=3,731); glycemic control in type 2 diabetes (LEAD program, Phase 3); 13% relative MACE reduction in high-CV-risk T2D patients (LEADER, n=9,340, median 3.8 years)
- Main caveat
- Clinically superseded by semaglutide and tirzepatide for weight-loss magnitude and dosing convenience in most adult populations; strongest current niche is pediatric and adolescent obesity; weight is largely regained within 1-2 years of discontinuation
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Liraglutide (sold as Victoza for type 2 diabetes and Saxenda for chronic weight management) is a daily injectable medication that mimics a gut hormone called GLP-1 (glucagon-like peptide-1). It tells the brain you've eaten enough, slows digestion, and helps the pancreas control blood sugar. The drug was developed by Novo Nordisk and has been FDA-approved since 2010 for diabetes and 2014 for obesity — making it the first GLP-1 receptor agonist approved specifically for weight management and the first in its class to show a reduction in cardiovascular deaths in a large outcomes trial. Today it occupies a particular niche in pediatric and adolescent obesity, where it holds dedicated approval down to age 6, and is increasingly accessible as generic versions have entered the US market since 2024.
Liraglutide shares 97% homology with the native human GLP-1 peptide. The stored sequence (HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR) is the bare amino-acid backbone; the active drug additionally carries a C-16 palmitic acid (palmitoyl) chain attached at Lys-26 via a γ-glutamic acid spacer — it is this lipid conjugation that enables reversible albumin binding, extending the half-life from approximately 2 minutes (native GLP-1) to approximately 13 hours and making once-daily dosing possible.
History
Liraglutide was developed by Novo Nordisk as a longer-acting analog of native GLP-1, which is degraded within minutes by the enzyme dipeptidyl peptidase-4 (DPP-4). The structural solution was a single amino-acid substitution (lysine to arginine at position 34 relative to native GLP-1) combined with the C-16 fatty acid lipidation at position 26, as described by Knudsen and colleagues (Frontiers in Endocrinology, 2019). These modifications protect the peptide from enzymatic degradation and enable albumin binding, creating the pharmacokinetic profile needed for once-daily use.
The FDA approved Victoza for type 2 diabetes in January 2010, following the LEAD (Liraglutide Effect and Action in Diabetes) program of six Phase III trials. The higher-dose Saxenda formulation gained FDA approval for chronic weight management in December 2014 — the first GLP-1 agonist indicated specifically for obesity. The landmark LEADER cardiovascular outcomes trial, completed in 2016, demonstrated a 13% relative reduction in major adverse cardiovascular events over a median 3.8 years in type 2 diabetes patients with high cardiovascular risk, establishing the first cardiovascular mortality benefit for the GLP-1 class. More recently, a dedicated randomized trial published in 2025 (Fox and colleagues) extended the pediatric evidence base to children aged 6 to under 12. Generic liraglutide entered the US market in 2024, making it the first GLP-1 receptor agonist to go generic.
What it does
Liraglutide activates the GLP-1 receptor in the pancreas, brain, and gut. In the pancreas, it triggers glucose-dependent insulin release and suppresses glucagon — lowering blood sugar without causing hypoglycemia when used alone. In the brain, it signals satiety centers in the hypothalamus and hindbrain, reducing appetite and food intake. It also slows gastric emptying, which blunts postprandial glucose spikes and contributes to a feeling of fullness after smaller meals.
For people with type 2 diabetes, the result is meaningful HbA1c reduction; for people with obesity, it produces moderate but clinically significant weight loss. The LEADER cardiovascular outcomes trial additionally showed a 13% relative reduction in major cardiovascular events over 3.8 years in high-risk type 2 diabetes patients — an effect attributed to the combination of metabolic improvement and potential direct cardioprotective signaling, though the precise mechanism underlying the cardiovascular benefit remains under investigation.
Liraglutide has largely been superseded by once-weekly semaglutide and tirzepatide for weight-loss magnitude and dosing convenience in most adult populations. The STEP 8 head-to-head trial showed semaglutide 2.4 mg weekly produced approximately 15.8% weight loss versus 6.4% with liraglutide 3.0 mg daily at 68 weeks. Liraglutide's current strongest niche is pediatric and adolescent obesity, where it holds dedicated approvals with specific trial support.
Evidence
- Human: Extensive. The LEAD program (six Phase III trials) established glycemic efficacy for type 2 diabetes. The SCALE Obesity and Prediabetes trial (n=3,731, 56 weeks) showed mean weight loss of 8.0% versus 2.6% with placebo, with approximately 33% of participants achieving ≥10% body weight loss. The LEADER cardiovascular outcomes trial (n=9,340, median 3.8 years) demonstrated a 13% relative reduction in major adverse cardiovascular events. A Phase III pediatric RCT in adolescents aged 12–17 (n=251) supported the Saxenda approval for that age group. The STEP 8 head-to-head trial directly compared weekly semaglutide 2.4 mg to daily liraglutide 3.0 mg in adults with overweight or obesity, showing semaglutide produced approximately twice the weight loss. A 2025 randomized trial (Fox and colleagues) extended pediatric evidence to children aged 6 to under 12. A 2025 systematic review and meta-analysis assessed liraglutide for adults with obesity. Post-marketing data now span over 15 years.
- Animal: Comprehensive preclinical program supported regulatory development. Rodent carcinogenicity studies identified the thyroid C-cell tumor signal that underlies the current boxed warning. Reproductive toxicity data in animals informed the label's pregnancy guidance.
- In vitro: Mechanistic work characterizing GLP-1 receptor binding and downstream cyclic AMP signaling is available in the literature; individual assay data are not individually extracted in this card.
Known effects
- Glycemic control (type 2 diabetes) — FDA-approved (Victoza); HbA1c reductions of 1.0–1.5 percentage points at 1.8 mg established in the LEAD program
- Chronic weight management (adults) — FDA-approved (Saxenda); ~8% mean weight loss at 56 weeks in SCALE Obesity and Prediabetes trial
- Chronic weight management (adolescents 12–17) — FDA-approved; supported by dedicated Phase III pediatric RCT
- Chronic weight management (children 6–<12) — Supported by a single randomized trial (Fox et al., 2025); evidence base smaller and shorter-duration than adult dataset
- Cardiovascular event reduction in high-risk T2D — Phase III outcomes trial (LEADER); 13% relative MACE reduction; applies to the high-cardiovascular-risk T2D population specifically
- Weight loss after bariatric surgery — Studied in multiple RCTs and meta-analyses; evidence for use in patients with insufficient weight loss or weight regain after metabolic surgery
- Cognitive and associative learning — A randomized trial showed liraglutide restored impaired associative learning in individuals with obesity; early-stage evidence
- Neuropsychiatric populations — A randomized trial in adults with stable bipolar disorder and obesity assessed weight-related outcomes; isolated study
Myths and misconceptions
"Victoza and Saxenda are different drugs." They are the same molecule — liraglutide — at different maximum doses (1.8 mg for Victoza, 3.0 mg for Saxenda) with different FDA-approved indications. The active pharmaceutical ingredient is identical.
"Liraglutide is obsolete now that semaglutide and tirzepatide exist." Liraglutide produces less weight loss than semaglutide or tirzepatide in head-to-head trials, but it retains clinically relevant niches: the longest post-marketing safety record in the GLP-1 class (15+ years), dedicated pediatric and adolescent approvals including children aged 6 and up, established cardiovascular outcomes data from LEADER, and generic availability that materially changes the cost picture for many patients.
"Daily dosing means worse side effects than once-weekly agents." Daily dosing creates more consistent pharmacokinetic exposure with less peak-to-trough variation than once-weekly agents. The STEP 8 head-to-head trial showed comparable gastrointestinal adverse event profiles between liraglutide and semaglutide; the trade-off with daily dosing is convenience, not necessarily tolerability.
"Liraglutide is automatically safer in children because it's been around longer." The adult safety record does not automatically transfer to pediatric populations. Liraglutide's pediatric approvals are backed by dedicated pediatric studies — but those studies are smaller and shorter in duration than the adult trial base. Long-term metabolic and developmental outcomes in children aged 6 to under 12 are still accruing.
Safety signals
- Gastrointestinal adverse events (nausea, vomiting, diarrhea, constipation): Most common adverse effects; particularly prominent at each upward titration step and typically attenuate over days. Reported across Phase III trials and the FDA label.
- Thyroid C-cell tumors: Boxed warning based on rodent carcinogenicity studies at clinically relevant exposures. No confirmed cases in humans to date. Contraindicated in patients with personal or family history of medullary thyroid carcinoma or MEN2.
- Pancreatitis: Rare (<1%); class-wide signal; contraindicated in active or recurrent pancreatitis; described in the FDA label and post-marketing data.
- Gallbladder disease (cholecystitis): Increased risk, associated with rapid weight loss; class-wide signal; described in the FDA label.
- Hypoglycemia risk with insulin or insulin secretagogues: Co-administration with insulin, sulfonylureas, or meglitinides materially increases hypoglycemia risk; described in the FDA label.
- Altered oral drug absorption: Delayed gastric emptying may affect absorption of orally administered drugs; the FDA label describes warfarin, levothyroxine, oral antibiotics, and antiepileptics as clinically relevant contexts.
- Mild resting heart rate elevation: A modest resting heart rate increase (~2–3 bpm) is a class effect observed across GLP-1 receptor agonist trials.
- Injection-site reactions: More frequent than with once-weekly GLP-1 agents due to daily injection frequency; described in the FDA label.
- Long-term pediatric safety in children aged 6–<12: Evidence base is a single dedicated trial; long-term metabolic and developmental outcomes in this younger age bracket are still accruing.
- Cardiovascular outcomes in non-T2D, lower-risk populations: LEADER established MACE reduction in high-cardiovascular-risk type 2 diabetes patients; cardiovascular outcomes in lower-risk or non-diabetic populations are not established by dedicated trials.
Regulatory status
- US (FDA): Prescription drug. Victoza approved January 2010 for type 2 diabetes (adults and pediatric patients ≥10 years). Saxenda approved December 2014 for chronic weight management (adults and adolescents 12–17 years). Generic liraglutide entered the US market in 2024 (Teva authorized generic of Victoza; Teva and Meitheal generic Saxenda launched 2025) — the first GLP-1 receptor agonist to go generic in the US.
- EU (EMA): Authorized. Victoza (Novo Nordisk) authorized 2009; Saxenda authorized 2015 for parallel indications. Current authorization status should be verified against the current EMA product database.
- UK (MHRA): Authorized per available sources; current status should be verified against the current MHRA database.
- Canada (Health Canada): Authorized per available sources.
- Australia (TGA): Authorized per available sources.
- WADA: Liraglutide is not listed by name on the WADA Prohibited List per available sources; GLP-1 agonists are under rising WADA scrutiny given weight-management applications. Athletes in weight-category or endurance sports should consult their governing body.
- Medicare Part D (US): Saxenda is excluded from Medicare Part D coverage for weight management; Victoza is covered for type 2 diabetes.
Mechanism
Liraglutide acts as an agonist at the GLP-1 receptor (GLP-1R), a class B G-protein-coupled receptor expressed in pancreatic islets, the central nervous system, the gastrointestinal tract, and cardiovascular tissue. Receptor activation increases cyclic AMP signaling, stimulating glucose-dependent insulin secretion from pancreatic beta cells and suppressing glucagon release from alpha cells. In the CNS, GLP-1R activation at hypothalamic and hindbrain satiety centers reduces appetite and food intake. Gastric emptying is delayed, contributing to postprandial glucose control and reduced caloric intake.
The structural modification distinguishing liraglutide from native GLP-1 involves two changes, as described by Knudsen and colleagues (Frontiers in Endocrinology, 2019): a lysine-to-arginine substitution at position 34 (GLP-1 numbering) that increases DPP-4 resistance, and a C-16 fatty acid (palmitic acid) chain attached at Lys-26 via a γ-glutamic acid spacer, enabling reversible non-covalent binding to albumin in plasma. Albumin binding slows renal clearance and protects against DPP-4 degradation, extending the half-life from approximately 2 minutes (native GLP-1) to approximately 13 hours — sufficient for once-daily subcutaneous dosing. Semaglutide uses a longer C-18 fatty diacid chain achieving tighter albumin affinity and a half-life of approximately one week, enabling once-weekly dosing.
The cardiovascular outcomes benefit demonstrated in LEADER is attributed to the combination of metabolic improvement and potential direct cardioprotective GLP-1R signaling in the heart and vasculature, though the precise mechanisms underlying MACE reduction remain under investigation.
Open questions
- Long-term pediatric safety in younger children: The 2025 randomized trial (Fox and colleagues) extends evidence to children aged 6 to under 12, but long-term metabolic and developmental outcomes in this younger bracket are still accruing. The pediatric dataset remains smaller and shorter in duration than the adult trial base.
- Generic equivalence in real-world practice: FDA bioequivalence approval supports the AB-rating of generic liraglutide, but comparative effectiveness and switching outcomes in real-world clinical practice have not yet matured as generics entered the market in 2024–2025.
- Daily versus once-weekly dosing in specific populations: Whether any patient subgroups — for pharmacodynamic, tolerability, or other reasons — systematically benefit from daily liraglutide over once-weekly GLP-1 agents remains underexplored. STEP 8 addressed body weight in adults without diabetes but not all subgroup contexts.
- Neuropsychiatric and neurodegenerative indications: Early signals in Alzheimer's disease and related cognitive indications are described in the available literature (the ELAD trial program is noted); liraglutide's shorter half-life may have mechanistic relevance for CNS indications relative to weekly agents. Results and full implications have not been individually extracted in this card.
- Post-discontinuation metabolic outcomes beyond weight: Weight regain after stopping is well-documented from SCALE extension data. Less characterized are the trajectories of glycemic control, cardiovascular risk markers, and renal function after discontinuation — particularly in patients who stop after extended treatment.
- Cardiovascular outcomes in non-T2D, lower-risk populations: LEADER established MACE reduction in type 2 diabetes patients with high cardiovascular risk. Whether the cardiovascular benefit extends to lower-risk populations or to patients treated for obesity without diabetes is not established by dedicated source-attached trials.
Related peptides
Liraglutide is part of the GLP-1 receptor agonist class. Closely related agents include semaglutide (a once-weekly GLP-1 analog with a longer C-18 fatty diacid chain and ~94% GLP-1 homology, producing greater weight loss than liraglutide in STEP 8), exenatide (the first GLP-1 agonist to reach market, derived from the Gila monster peptide exendin-4), and tirzepatide (a dual GIP/GLP-1 receptor agonist with the largest weight-loss effect size in the class to date). Dulaglutide is another once-weekly GLP-1 analog approved for type 2 diabetes.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Might changing the small chemical bridge that holds liraglutide's fat tail allow us to make versions that last a day, a week, or somewhere in between?
If true, patients could choose a dosing schedule that fits their life, and doctors could adjust how long the drug lasts based on a person's body chemistry without redesigning the whole drug
Might a specific bend in the middle of liraglutide change how the receptor sends signals inside the cell, compared to natural GLP-1 or other drugs?
If true, drug designers could tweak that bend to create GLP-1 drugs with fewer side effects or stronger weight loss, giving patients better options than the one-size-fits-all drugs available today
Might the way liraglutide sticks to albumin in the bloodstream help keep blood sugar stable when someone is very sick or after surgery?
If true, doctors might use liraglutide to prevent dangerous blood sugar spikes in hospitalized patients, a group that currently relies on insulin drips and frequent monitoring
Could the shortened end of liraglutide affect how the GLP-1 receptor is recycled inside cells, not just how strongly it turns on?
If this is true, drug developers could tune liraglutide-like drugs for longer or shorter receptor activation, which might help patients who stop responding well to current GLP-1 drugs over time
Could the acidic environment around tumors make liraglutide less effective for cancer-related weight loss than for diabetes?
If true, we could redesign liraglutide to stay active in acidic tissues, potentially helping cancer patients maintain muscle and weight, or conversely design it to turn off in healthy tissue and on only in tumors
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.9285981059074402 | boltz-2 |
| ranking score | 0.7962026596069336 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.871 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸chemical idInChIKey
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | colabfold_nvidia |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-05-03 |
▸citationbibtex
@peptide{pep10868,
sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}