pe
pep-10773 v1 CC-BY-SA-4.0

GLP-1 receptor blocker for lab research (Exendin-4 4: 39)

A fragment of the Gila monster peptide that inspired the diabetes drug Byetta; blocks the GLP-1 receptor to help scientists study how diabetes and weight-loss drugs bind, used only as a lab research tool.

statusbioassayed targetGLP-1R length36 aa refs6
status 4 / 5 · 2 verified on platform
prediction metrics boltz-2 1.0
ipTM0.895
pTM0.840
avg pLDDT73.9
ranking score0.770
STRUCTURE · PEP-10773 × GLP-1R
ranking0.770
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence36 aa
1510152025303536
GTFTSDLSKQMEEEAVRL FIEWLKNGGPSSGAPPPS
in the news 136 articles
overview readme

What this is

Exendin-4 (4–39) is a truncated research fragment derived from exendin-4, the 39-residue peptide originally isolated from the saliva of the Gila monster lizard that became the basis for the diabetes drug exenatide (Byetta). The fragment is missing the first three amino acids of the parent peptide — histidine, glycine, and glutamate — which are essential for activating the GLP-1 receptor. As a result, exendin-4 (4–39) does not fully activate the receptor the way the parent molecule does; instead it competes for the same binding site and can block or partially inhibit receptor activation, making it a valuable pharmacological tool for dissecting how GLP-1 receptor ligands bind and signal (Donnelly 2012; Graaf and colleagues 2016).

History

Exendin-4 was first described in the early 1990s as an unusual insulinotropic peptide from Gila monster (Heloderma suspectum) venom. Parkes and colleagues (2013) chronicle how the peptide's resistance to the enzyme DPP-4 — due in part to a glycine rather than alanine at position 2 of the mature sequence — gave it a far longer biological half-life than native GLP-1, ultimately leading to the development of exenatide as the first GLP-1 receptor agonist approved for clinical use (Byetta, 2005). The truncated 4–39 fragment emerged as a pharmacological tool during the extensive structure–activity relationship work that accompanied exenatide's development, as researchers needed a way to selectively occupy the GLP-1 receptor without triggering full activation — a classic antagonist or partial-agonist strategy used to map receptor pharmacology (Donnelly 2012).

What it does

By binding the GLP-1 receptor without delivering the N-terminal activation signal, exendin-4 (4–39) can attenuate or block the effects that full agonists — including native GLP-1, exendin-4, and GLP-1 receptor agonist drugs — normally produce at that receptor. Those effects include stimulation of insulin secretion from pancreatic beta cells, suppression of glucagon release, slowing of gastric emptying, and promotion of satiety (Meloni and colleagues 2012). In experimental settings, the fragment has been used to confirm that an observed effect is GLP-1 receptor–mediated: if co-administration of exendin-4 (4–39) blocks the effect, that implicates the receptor (Donnelly 2012). It is not used therapeutically.

Evidence

  • Human: No human trials. Exendin-4 (4–39) is a research reagent, not a clinical compound.
  • Animal: Used in rodent models as a pharmacological tool to competitively displace GLP-1 receptor agonists and establish receptor-mediated mechanisms (Donnelly 2012).
  • In vitro: Used in receptor-binding competition assays and cell-based signaling studies to probe how the GLP-1 receptor's extracellular and transmembrane domains engage agonists (Yang and colleagues 2016; Zhao and colleagues 2016).

Mechanism

The GLP-1 receptor is a Class B G protein–coupled receptor (GPCR). Full agonist activation by GLP-1 or exendin-4 involves a two-step process: the C-terminal portion of the ligand docks to the receptor's extracellular domain, and the N-terminal portion (especially the first few residues, including histidine-1) then engages the transmembrane bundle core to trigger Gαs coupling, cAMP elevation, and downstream insulin secretion (Yang and colleagues 2016; Zhao and colleagues 2016; Graaf and colleagues 2016). Exendin-4 (4–39) retains the C-terminal region that contacts the extracellular domain but lacks the N-terminal activation trigger. It can therefore bind and occupy the receptor without initiating full signal transduction, acting as a competitive antagonist or weak partial agonist depending on the cellular context — a property that has made it indispensable for dissecting Class B GPCR pharmacology (Donnelly 2012; Zhao and colleagues 2016).

Known effects

  • GLP-1R competitive antagonism / partial agonism — Pharmacological tool; in vitro and animal models (Donnelly 2012; Yang and colleagues 2016)
  • Blockade of GLP-1R–mediated insulin secretion — Used to confirm receptor-dependent effects in experimental systems (Meloni and colleagues 2012)
  • No therapeutic indication — Research reagent only; no clinical use

Related peptides

Exendin-4 (4–39) is a fragment of the full-length exendin-4 peptide. For the parent molecule and its clinical development as the first approved GLP-1 receptor agonist, see the exenatide card. The GLP-1 receptor it targets is the same receptor activated by liraglutide, semaglutide, and all other approved GLP-1 receptor agonists in the incretin drug class; the receptor's structure and pharmacology are reviewed in depth by Donnelly (2012) and Graaf and colleagues (2016).

Hypotheses6 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could the back half of a peptide drug be solely responsible for choosing the correct receptor, with no help from the front?

If true, drug designers could build highly selective GLP-1 receptor blockers using just this shorter fragment, reducing the risk of accidentally triggering glucagon signaling, which could cause dangerous blood sugar swings. This matters for anyone developing research tools or treatments that need to block GLP-1 signaling without side effects.

The hypothesis
Exendin-4 (4-39) binds the GLP-1R extracellular domain with higher affinity than it binds the homologous glucagon receptor (GCGR) extracellular domain, such that the >100-fold selectivity ratio for GLP-1R over GCGR resides entirely in the C-terminal helix and linker region rather than requiring the N-terminal activation triplet.
Why it’s plausible
The sequence GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS retains the full C-terminal alpha-helical and tryptophan-cage scaffold of exendin-4 that docks to the extracellular domain. Literature from Yang et al. (2016) and Zhao et al. (2016) establishes that the C-terminal portion mediates extracellular domain contacts in a two-step binding mechanism. GLP-1R and GCGR extracellular domains share only ~40% identity at the peptide-docking surface, so the C-terminal residues alone may encode the receptor selectivity observed for full exendin-4 without any contribution from the missing H1-G2-E3 triplet.
Why it matters
If selectivity is fully encoded in residues 4-39, the fragment could serve as a minimal selectivity scaffold for designing GLP-1R-specific competitive antagonists without the risk of cross-activating glucagon signaling, which is important for tool compound design and for building bivalent probes.
Plausibility.71
Novelty.47
Impact.53
Basis · grounding3 papers · 1 computed/note
[1]
paper
Structural determinants of binding the seven-transmembrane domain of GLP-1R; extracellular domain contacts mapped
doi: 10.1074/jbc.m116.721977
[2]
paper
Differential requirement of extracellular domain in activation of class B GPCRs; C-terminal fragment docking mechanism
doi: 10.1074/jbc.m116.726620
[3]
paper
Comprehensive review of GLP-1R residues governing ligand recognition; receptor selectivity determinants
doi: 10.1124/pr.115.011395
[4]
sequenceFull C-terminal helix (RLFIEWLK) and tryptophan-cage precursor region retained; N-terminal HGE activation triplet absent
openupdated 2026-06-05

Does a small cluster of rigid amino acids at the end of this peptide act like a clamp that holds the whole structure in the right shape?

If this proline cluster turns out to be essential for binding, any drug built on this scaffold would need to keep it intact, a non-obvious design rule that could save years of failed experiments. It might also explain why a reptile-derived peptide (exendin-4) outcompetes the body's own hormone at the same receptor.

The hypothesis
The C-terminal PPPS motif in the sequence (positions 33-36) acts as a conformational constraining element that rigidifies the tryptophan-cage-like fold of the bound peptide and is required for nanomolar-range GLP-1R extracellular domain affinity, such that truncation to residue 32 or substitution of any proline in PPPS substantially lowers binding affinity.
Why it’s plausible
The sequence ends in GGPSSGAPPPS. Proline residues within peptide C-termini of exendin-4-family ligands are well documented to form a tryptophan cage structure that stabilizes the bioactive helix conformation, as reviewed by Donnelly (2012) and Graaf et al. (2016). This proline-rich tail is absent from native GLP-1 and is one reason exendin-4 has higher GLP-1R affinity than GLP-1 itself. The Boltz-2 prediction has a high ipTM of 0.895, consistent with a well-defined bound pose, which likely depends on this structured C-terminus.
Why it matters
If the PPPS segment is load-bearing for high-affinity receptor binding, it defines a non-obvious pharmacophoric element that must be preserved in any engineered derivative of this antagonist scaffold. This would also explain why full exendin-4 outcompetes GLP-1 at its own receptor despite GLP-1 being the endogenous ligand.
Plausibility.65
Novelty.37
Impact.55
Basis · grounding2 papers · 2 computed/notes
[1]
paper
Structure-function of GLP-1R ligands including exendin-4; C-terminal cage structure discussed
doi: 10.1111/j.1476-5381.2011.01687.x
[2]
paper
GLP-1R review; structural differences between GLP-1 and exendin-4 including C-terminal extension
doi: 10.1124/pr.115.011395
[3]
structureipTM 0.895 indicates high-confidence interface structure consistent with a well-packed C-terminal binding mode
[4]
sequenceTerminal sequence ends GGPSSGAPPPS; three prolines in last four residues form tryptophan-cage-supporting element unique to exendin-class peptides
openupdated 2026-06-05

Could a slightly shortened version of a diabetes drug activate only the beneficial cellular pathway while skipping the one that leads to tolerance and side effects?

GLP-1 drugs like semaglutide lose effectiveness over time partly because cells become desensitized. If this fragment preferentially triggers one pathway (beta-arrestin) while skipping the one tied to desensitization (Gs-cAMP), it could point toward a next-generation drug that maintains its effect longer, a meaningful gain for the millions of people on long-term GLP-1 therapy.

The hypothesis
Exendin-4 (4-39) acts as a biased partial agonist rather than a pure competitive antagonist, preferentially engaging the beta-arrestin recruitment pathway over Gs-cAMP signaling at GLP-1R, because the missing N-terminal histidine eliminates the transmembrane-bundle contacts required for Gs coupling but leaves intact the extracellular domain contacts that stabilize beta-arrestin-competent receptor conformations.
Why it’s plausible
Class B GPCR activation by GLP-1 family peptides involves the N-terminal histidine inserting into the transmembrane bundle core to trigger Galphas coupling. The sequence here begins with G (Gly, position 4 of exendin-4), so the histidine-dependent transmembrane engagement is absent. However, the full C-terminal amphipathic helix (containing RLFIEWLK) remains and can stabilize receptor conformations associated with beta-arrestin recruitment, which does not require the same transmembrane engagement geometry. Biased signaling at GLP-1R has been reported with truncated and modified ligands in the literature cited.
Why it matters
Confirming beta-arrestin-biased partial agonism would reframe this fragment from a simple antagonist tool to a scaffold for developing biased GLP-1R ligands. Beta-arrestin-biased GLP-1R agonism has been proposed to dissociate the therapeutic insulin secretion effect from receptor desensitization, which is a major limitation of current GLP-1R drugs.
Plausibility.37
Novelty.67
Impact.67
Basis · grounding2 papers · 2 computed/notes
[1]
paper
GLP-1R desensitization involves receptor phosphorylation and beta-arrestin recruitment; modulatory roles of receptor regions
doi: 10.1111/j.1476-5381.2011.01687.x
[2]
paper
Biased agonism at GLP-1R reviewed as a therapeutic strategy
doi: 10.1016/j.peptides.2024.171168
[3]
noteFragment described as competitive antagonist or weak partial agonist depending on cellular context, implying context-dependent signaling profile
[4]
sequenceN-terminal HGE absent; RLFIEWLK amphipathic helix retained, capable of receptor surface engagement without transmembrane core penetration
openupdated 2026-06-05

Could a single chemical modification, adding a fat chain to one amino acid, stretch a peptide's life in the body from minutes to hours without ruining how it works?

Right now there is no long-acting drug that blocks the GLP-1 receptor. If this modification works without disrupting binding, it could become a practical research tool and potentially a treatment for conditions where GLP-1 signaling is dangerously overactive. The strategy mirrors how semaglutide was engineered, so it has prior plausibility.

The hypothesis
Conjugating a fatty acid chain or albumin-binding moiety to the lysine at position 25 of the fragment (K in the RLFIEWLK helix) extends plasma half-life from minutes to hours without abolishing GLP-1R competitive antagonism, because this lysine faces away from the receptor-binding interface in the helical bound conformation.
Why it’s plausible
The sequence RLFIEWLK contains a lysine (K) at the C-terminal end of the amphipathic helix. Semaglutide's extended half-life strategy relied on fatty acid conjugation to a non-interface lysine in a GLP-1 analog, as noted in the axis hits on half-life and proteolytic stability. The Boltz-2 structure (ipTM 0.895) places this helix on the receptor surface; in an amphipathic helix, every third to fourth residue alternates between the receptor face and the solvent face, and K in RLFIEWLK occupies the solvent-facing position. DPP-4 cleaves after position 2 of the mature sequence (which is absent here), so the main degradation route would be general proteolysis, and acylation would sterically protect against that while extending vascular retention.
Why it matters
A long-acting GLP-1R competitive antagonist would be useful as a research tool with improved pharmacokinetics and could also serve as a lead for treating pathological GLP-1R overactivation states such as hyperinsulinism. Currently no long-acting GLP-1R antagonist exists; this fragment is the closest available scaffold.
Plausibility.48
Novelty.38
Impact.52
Basis · grounding1 paper · 3 computed/notes
[1]
paper
GLP-1 native half-life approximately 2 minutes; strategies for half-life extension reviewed including fatty acid conjugation
doi: 10.1039/d5sm00801h
[2]
sourceDPP-4 cleavage at His-Ala bond position 7-8 of GLP-1; taspoglutide Aib substitution prevents cleavage; relevance to proteolytic vulnerability of this fragment
[3]
structureipTM 0.895 Boltz-2 complex; high-confidence helical interface suggests K in RLFIEWLK is on solvent face and accessible for conjugation without disrupting binding
[4]
sequenceRLFIEWLK helix: leucines and phenylalanine form hydrophobic receptor-facing face; K is at helix terminus pointing toward solvent in canonical amphipathic helix geometry
openupdated 2026-06-05

Could blocking the GLP-1 receptor calm down the runaway insulin secretion that endangers babies born with congenital hyperinsulinism?

Congenital hyperinsulinism is a rare but serious condition where newborns secrete too much insulin, risking brain damage from chronically low blood sugar. Current drugs have significant side effects and often fail. If this peptide fragment normalizes insulin levels in disease models, it could validate a new treatment direction for families with very few options.

The hypothesis
Exendin-4 (4-39) suppresses the hyperactive GLP-1R signaling that has been identified in a subset of insulinoma (pancreatic beta-cell tumor) cells, and would reduce the pathological insulin hypersecretion characteristic of nesidioblastosis and congenital hyperinsulinism, making it a candidate tool compound for studying these conditions and a lead for developing a GLP-1R antagonist therapy.
Why it’s plausible
Congenital hyperinsulinism and nesidioblastosis involve constitutively elevated or agonist-driven GLP-1R-mediated insulin secretion in beta cells. A potent, receptor-selective competitive antagonist at GLP-1R would attenuate this hypersecretion. Current treatment relies on diazoxide or octreotide with significant side-effect profiles. Exendin-4 (4-39) is the only well-characterized, receptor-selective GLP-1R antagonist peptide available, making it the natural tool to probe this question. The fragment's lack of agonist activity, confirmed by the absence of the N-terminal histidine activation motif, is a prerequisite for this application.
Why it matters
Hyperinsulinism is a life-threatening neonatal condition with limited pharmacological options. Demonstrating that exendin-4 (4-39) normalizes insulin secretion in hyperinsulinism models would validate the GLP-1R antagonist concept as a therapeutic direction, potentially justifying development of a stabilized, longer-acting version of this fragment for clinical use.
Plausibility.34
Novelty.22
Impact.52
Basis · grounding2 papers · 2 computed/notes
[1]
paper
Exenatide-mediated insulin secretion is glucose-dependent and GLP-1R mediated; corollary: antagonism should reduce pathological hypersecretion
doi: 10.1111/j.1463-1326.2012.01663.x
[2]
noteFragment confirmed to block GLP-1R-mediated insulin secretion in experimental systems
[3]
paper
Competitive displacement of GLP-1R agonists by truncated exendin-4 variants; receptor occupancy data
doi: 10.1074/jbc.m116.721977
[4]
sequenceNo N-terminal histidine: confirms zero intrinsic agonist drive on Gs-cAMP pathway; pure antagonist action on insulin secretion expected
openupdated 2026-06-05

Is the nausea that makes many people quit semaglutide or similar drugs caused by GLP-1 receptor activity specifically in the brain?

Nausea is the top reason people reduce their dose or stop GLP-1 drugs like semaglutide entirely. If experiments with this peptide confirm that the nausea signal comes from brain GLP-1 receptors, it opens the door to add-on treatments that block only that signal, potentially letting patients take higher, more effective doses without feeling sick.

The hypothesis
Exendin-4 (4-39) attenuates GLP-1R-mediated neuroinflammatory signaling in the hypothalamus and reduces the central satiety drive that contributes to GLP-1 receptor agonist drug-induced nausea and anorexia, suggesting that a peripherally restricted version would not be sufficient and that central GLP-1R occupancy is required.
Why it’s plausible
GLP-1R agonist-induced nausea is believed to involve central GLP-1R in the area postrema and nucleus tractus solitarius. Using exendin-4 (4-39) as a centrally delivered antagonist in preclinical models to block this nausea response would determine whether it is GLP-1R-mediated rather than off-target. The fragment's competitive binding mode means a sufficient dose should fully block the nausea-inducing effect of exenatide at central receptors, as its binding affinity at brain GLP-1R is expected to mirror that at peripheral receptors. The axis-hits on clinical translation reference side-effect management for GLP-1R agonists as a major unresolved problem.
Why it matters
Nausea is the primary dose-limiting adverse effect of all approved GLP-1R agonist drugs. Demonstrating that central GLP-1R occupancy by exendin-4 (4-39) blocks agonist-induced emesis would confirm the central mechanism and motivate development of add-on GLP-1R partial antagonists as anti-nausea co-therapeutics for patients on semaglutide or tirzepatide.
Plausibility.35
Novelty.25
Impact.40
Basis · grounding3 papers · 1 computed/note
[1]
paper
GLP-1R agonists: broad spectrum of medical applications; gastrointestinal adverse events a clinical barrier to dose escalation
doi: 10.1007/s11883-025-01350-7
[2]
paper
GLP-1R agonist clinical trial data; nausea/vomiting as primary side effect limiting uptake and dose
doi: 10.1056/nejmoa2501006
[3]
noteFragment blocks GLP-1R-mediated satiety and gastric emptying effects in experimental settings; confirms CNS-relevant receptor occupancy principle
[4]
paper
GLP-1R distribution includes CNS; class B GPCR pharmacology review confirms central receptor engagement
doi: 10.1124/pr.115.011395
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8945858478546143 boltz-2
ranking score 0.7700555920600891 boltz-2
3-letter notation
Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategycolabfold_nvidia
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-25
citationbibtex
peptidemodel (2026). GLP-1 receptor blocker for lab research (Exendin-4 4: 39) (pep-10773, v1). PeptideModel. https://peptidemodel.com/card/pep-10773
@peptide{pep10773,
  sequence = {GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
  target   = {glp-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 405 on ct.gov · 28 on EUCTR · checked 2026-05-22
ct.gov trials 405
with results 132
EUCTR 28
PubMed RCT 15
by phase
2phase 11phase 22phase 32phase 43no phase
by status
6completed1recruiting1terminated2unknown
references 6 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use