GLP-1 receptor blocker for lab research (Exendin-4 4: 39)
A fragment of the Gila monster peptide that inspired the diabetes drug Byetta; blocks the GLP-1 receptor to help scientists study how diabetes and weight-loss drugs bind, used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Named peptide fragment — synthesized for research; ClinicalTrials.gov trials registered for parent compound or class
Fork this card to add platform evidence →
Endogenous peptide fragment — receptor binding/activity established in published literature; CT.gov evidence
Fork this card to add platform evidence →
What this is
Exendin-4 (4–39) is a truncated research fragment derived from exendin-4, the 39-residue peptide originally isolated from the saliva of the Gila monster lizard that became the basis for the diabetes drug exenatide (Byetta). The fragment is missing the first three amino acids of the parent peptide — histidine, glycine, and glutamate — which are essential for activating the GLP-1 receptor. As a result, exendin-4 (4–39) does not fully activate the receptor the way the parent molecule does; instead it competes for the same binding site and can block or partially inhibit receptor activation, making it a valuable pharmacological tool for dissecting how GLP-1 receptor ligands bind and signal (Donnelly 2012; Graaf and colleagues 2016).
History
Exendin-4 was first described in the early 1990s as an unusual insulinotropic peptide from Gila monster (Heloderma suspectum) venom. Parkes and colleagues (2013) chronicle how the peptide's resistance to the enzyme DPP-4 — due in part to a glycine rather than alanine at position 2 of the mature sequence — gave it a far longer biological half-life than native GLP-1, ultimately leading to the development of exenatide as the first GLP-1 receptor agonist approved for clinical use (Byetta, 2005). The truncated 4–39 fragment emerged as a pharmacological tool during the extensive structure–activity relationship work that accompanied exenatide's development, as researchers needed a way to selectively occupy the GLP-1 receptor without triggering full activation — a classic antagonist or partial-agonist strategy used to map receptor pharmacology (Donnelly 2012).
What it does
By binding the GLP-1 receptor without delivering the N-terminal activation signal, exendin-4 (4–39) can attenuate or block the effects that full agonists — including native GLP-1, exendin-4, and GLP-1 receptor agonist drugs — normally produce at that receptor. Those effects include stimulation of insulin secretion from pancreatic beta cells, suppression of glucagon release, slowing of gastric emptying, and promotion of satiety (Meloni and colleagues 2012). In experimental settings, the fragment has been used to confirm that an observed effect is GLP-1 receptor–mediated: if co-administration of exendin-4 (4–39) blocks the effect, that implicates the receptor (Donnelly 2012). It is not used therapeutically.
Evidence
- Human: No human trials. Exendin-4 (4–39) is a research reagent, not a clinical compound.
- Animal: Used in rodent models as a pharmacological tool to competitively displace GLP-1 receptor agonists and establish receptor-mediated mechanisms (Donnelly 2012).
- In vitro: Used in receptor-binding competition assays and cell-based signaling studies to probe how the GLP-1 receptor's extracellular and transmembrane domains engage agonists (Yang and colleagues 2016; Zhao and colleagues 2016).
Mechanism
The GLP-1 receptor is a Class B G protein–coupled receptor (GPCR). Full agonist activation by GLP-1 or exendin-4 involves a two-step process: the C-terminal portion of the ligand docks to the receptor's extracellular domain, and the N-terminal portion (especially the first few residues, including histidine-1) then engages the transmembrane bundle core to trigger Gαs coupling, cAMP elevation, and downstream insulin secretion (Yang and colleagues 2016; Zhao and colleagues 2016; Graaf and colleagues 2016). Exendin-4 (4–39) retains the C-terminal region that contacts the extracellular domain but lacks the N-terminal activation trigger. It can therefore bind and occupy the receptor without initiating full signal transduction, acting as a competitive antagonist or weak partial agonist depending on the cellular context — a property that has made it indispensable for dissecting Class B GPCR pharmacology (Donnelly 2012; Zhao and colleagues 2016).
Known effects
- GLP-1R competitive antagonism / partial agonism — Pharmacological tool; in vitro and animal models (Donnelly 2012; Yang and colleagues 2016)
- Blockade of GLP-1R–mediated insulin secretion — Used to confirm receptor-dependent effects in experimental systems (Meloni and colleagues 2012)
- No therapeutic indication — Research reagent only; no clinical use
Related peptides
Exendin-4 (4–39) is a fragment of the full-length exendin-4 peptide. For the parent molecule and its clinical development as the first approved GLP-1 receptor agonist, see the exenatide card. The GLP-1 receptor it targets is the same receptor activated by liraglutide, semaglutide, and all other approved GLP-1 receptor agonists in the incretin drug class; the receptor's structure and pharmacology are reviewed in depth by Donnelly (2012) and Graaf and colleagues (2016).
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could the back half of a peptide drug be solely responsible for choosing the correct receptor, with no help from the front?
If true, drug designers could build highly selective GLP-1 receptor blockers using just this shorter fragment, reducing the risk of accidentally triggering glucagon signaling, which could cause dangerous blood sugar swings. This matters for anyone developing research tools or treatments that need to block GLP-1 signaling without side effects.
Does a small cluster of rigid amino acids at the end of this peptide act like a clamp that holds the whole structure in the right shape?
If this proline cluster turns out to be essential for binding, any drug built on this scaffold would need to keep it intact, a non-obvious design rule that could save years of failed experiments. It might also explain why a reptile-derived peptide (exendin-4) outcompetes the body's own hormone at the same receptor.
Could a slightly shortened version of a diabetes drug activate only the beneficial cellular pathway while skipping the one that leads to tolerance and side effects?
GLP-1 drugs like semaglutide lose effectiveness over time partly because cells become desensitized. If this fragment preferentially triggers one pathway (beta-arrestin) while skipping the one tied to desensitization (Gs-cAMP), it could point toward a next-generation drug that maintains its effect longer, a meaningful gain for the millions of people on long-term GLP-1 therapy.
Could a single chemical modification, adding a fat chain to one amino acid, stretch a peptide's life in the body from minutes to hours without ruining how it works?
Right now there is no long-acting drug that blocks the GLP-1 receptor. If this modification works without disrupting binding, it could become a practical research tool and potentially a treatment for conditions where GLP-1 signaling is dangerously overactive. The strategy mirrors how semaglutide was engineered, so it has prior plausibility.
Could blocking the GLP-1 receptor calm down the runaway insulin secretion that endangers babies born with congenital hyperinsulinism?
Congenital hyperinsulinism is a rare but serious condition where newborns secrete too much insulin, risking brain damage from chronically low blood sugar. Current drugs have significant side effects and often fail. If this peptide fragment normalizes insulin levels in disease models, it could validate a new treatment direction for families with very few options.
Is the nausea that makes many people quit semaglutide or similar drugs caused by GLP-1 receptor activity specifically in the brain?
Nausea is the top reason people reduce their dose or stop GLP-1 drugs like semaglutide entirely. If experiments with this peptide confirm that the nausea signal comes from brain GLP-1 receptors, it opens the door to add-on treatments that block only that signal, potentially letting patients take higher, more effective doses without feeling sick.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8945858478546143 | boltz-2 |
| ranking score | 0.7700555920600891 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | colabfold_nvidia |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-25 |
▸citationbibtex
@peptide{pep10773,
sequence = {GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS},
target = {glp-1r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}