pe
pep-10772 v1 CC-BY-SA-4.0

Longer-lasting gut insulin signal (GIP Pro3 analog)

A lab-made version of the gut hormone GIP, tweaked to survive longer in the bloodstream so it can stimulate insulin release for longer; used only as a lab research tool.

statusbioassayed targetGIPR length42 aa refs7
status 4 / 5 · 2 verified on platform
prediction metrics openfold3-mlx 0.3.1
ipTM0.704
pTM0.714
avg pLDDT54.5
ranking score0.780
STRUCTURE · PEP-10772 × GIPR
ranking0.780
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence42 aa
151015202530354042
YAPGTFISDYSIAM DKIHQQDFVNWLLA QKGKKNDWKHNITQ
in the news 62 articles
overview readme

What this is

GIP(Pro3) — also written (Pro3)GIP — is a synthetic analog of GIP (glucose-dependent insulinotropic polypeptide), a gut-derived incretin hormone that stimulates insulin release after meals. It was engineered to resist breakdown by the enzyme DPP-4, which normally inactivates native GIP within roughly 7 minutes in the circulation. The single structural change is a proline substitution at position 3 of the mature GIP sequence — where native GIP carries glutamic acid, (Pro3)GIP carries proline — and that one swap is enough to block the primary DPP-4 cleavage site entirely. The stored 42-residue sequence (beginning Y-A-P-G-T-F…) reflects this substitution: position 3 is proline. Researchers have used (Pro3)GIP primarily as a pharmacological tool to dissect GIPR signalling in rodent models, though a key 2016 study showed its pharmacology at the human receptor is fundamentally different from what rodent work had implied.

History

GIP was first purified from porcine intestinal extracts in 1969 by John Brown and colleagues, initially named "gastric inhibitory polypeptide"; its more consequential function as the first identified incretin hormone — stimulating glucose-dependent insulin secretion from pancreatic beta cells — was established in subsequent years. GIP and GLP-1 together are responsible for the majority of the incretin effect in healthy humans (reviewed by Drucker and colleagues, Annual Review of Physiology, 2014). GIP is secreted by K cells in the upper small intestine and circulates as the biologically active 42-residue form until DPP-4 cleaves the Ala2–Glu3 bond to generate the inactive GIP(3-42) metabolite.

(Pro3)GIP was first characterised in 2002 by Victor Gault and Peter Flatt's group at Ulster University. Their design principle was straightforward: substituting proline at the DPP-4 scissile position should simultaneously protect the peptide from rapid degradation and — by disrupting the N-terminal binding geometry — render it a GIPR antagonist. In rodent experiments the compound appeared to fulfil both goals, and it rapidly became the most widely used chemical tool for probing GIP receptor function in mice and rats. A PEGylated derivative, (Pro3)GIP[mPEG], was later developed to extend the dosing interval in animal studies.

What it does

In rodent models, (Pro3)GIP behaves as a GIPR antagonist and has been used to interrogate what happens metabolically when GIP signalling is suppressed. Chronic daily treatment in diet-induced obese mice reversed body-weight gain, restored plasma glucose and glycated haemoglobin toward normal, improved glucose tolerance and insulin sensitivity, and reduced circulating triglycerides and cholesterol (American Journal of Physiology-Endocrinology and Metabolism, 2008). In genetically obese ob/ob mice, early administration over 60 days prevented the development of diabetes and related metabolic abnormalities (Diabetologia, 2007). These findings supported the idea that blocking GIPR could be a therapeutic approach to obesity-related metabolic disease — a concept that has subsequently evolved in complex ways with the clinical success of the dual GIPR/GLP-1R agonist tirzepatide.

The pharmacological picture changed substantially with the 2016 study by Sparre-Ulrich and colleagues (British Journal of Pharmacology). Using transfected cells expressing human, rat, or mouse GIPR in cAMP accumulation assays, they showed that human (Pro3)GIP is a near-full agonist at the human GIP receptor — with an Emax of approximately 90% relative to native human GIP and an EC50 of 4.7 nM — not a competitive antagonist. At rat and mouse GIPRs, (Pro3)GIP is a partial agonist (Emax ~64% and ~59%, respectively) with competitive antagonist activity (Ki 13 nM at the rat receptor; 61 nM at the mouse receptor). These findings mean that rodent studies using (Pro3)GIP to "block" the GIPR were actually measuring a mixture of partial agonism and antagonism — and that this pharmacology does not translate to the human receptor.

Evidence

  • Human: No clinical trials involving (Pro3)GIP have been registered or published. It is a research tool, not a clinical candidate.
  • Animal: Extensively used in rodent models as an apparent GIPR antagonist. Preclinical studies demonstrated metabolic benefits in diet-induced and genetically obese mice (improved glucose tolerance, reduced body weight, normalised lipid profile). The Sparre-Ulrich 2016 finding of partial agonism at rodent GIPRs requires that earlier murine results be interpreted cautiously.
  • In vitro: Sparre-Ulrich and colleagues (British Journal of Pharmacology, 2016) characterised (Pro3)GIP pharmacology at human, rat, and mouse GIPRs using cAMP accumulation and competition binding assays with ¹²⁵I-human GIP. Full agonism at the human receptor (EC50 4.7 nM, Emax ~90%) and partial agonism with competitive antagonism at rodent receptors (Ki 13 nM rat, 61 nM mouse) were the central findings. The GIP system in the context of obesity and type 2 diabetes research is reviewed in Müller and colleagues (Molecular Metabolism, 2025) and Bailey and colleagues (Peptides, 2024).

Mechanism

(Pro3)GIP binds GIPR, a class B G protein-coupled receptor that couples to Gαs to drive cAMP production in pancreatic beta cells, adipocytes, and other tissues. The Glu3→Pro substitution removes the DPP-4 cleavage site at the Ala2–Glu3 bond, conferring full resistance to this primary inactivation route. At the human GIPR, (Pro3)GIP activates the receptor with near-native efficacy through this same cAMP-PKA pathway. At rodent GIPRs, the identical molecule elicits only partial receptor activation while simultaneously competing with native GIP for binding — a dual partial-agonist/competitive-antagonist profile. Sparre-Ulrich and colleagues attributed the species divergence to differences in the GIP receptor's ligand-binding pocket between humans and rodents, and concluded that "human (Pro3)GIP is not an antagonist at human GIP receptors," advising caution in extrapolating rodent pharmacology data (Sparre-Ulrich et al., 2016).

Open questions

  • What is the precise structural basis for the species-specific pharmacological divergence at rodent versus human GIPR?
  • Does (Pro3)GIP's full agonism at the human GIPR affect its utility as a dissection tool in human cell or tissue experiments?
  • No head-to-head comparison of (Pro3)GIP with selective GIPR antagonist antibodies has been published for human receptor assays.
  • Proteolytic stability outside the DPP-4 pathway (e.g., neutral endopeptidases) has not been fully characterised.

Related peptides

  • GIP (1–42) human — the endogenous 42-residue incretin hormone from which (Pro3)GIP is derived; released from duodenal K cells after eating.
  • Tirzepatide — dual GIP/GLP-1R agonist approved for type 2 diabetes and obesity; the same GIPR pathway that (Pro3)GIP has been used to study in rodents.
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Could a DPP-4-resistant peptide that still activates the human GIP receptor inform next-generation dual-action drug design?

Published data show (Pro3)GIP activates the human receptor near-fully and resists rapid breakdown, so it is a reasonable scaffold to study for the GIPR side of combination therapies, without claiming it matches any approved drug.

The hypothesis
GIP(Pro3) retains sufficient GIPR agonism in humans to potentiate the insulin-secretion effect of GLP-1 receptor co-agonist drugs (such as tirzepatide-class dual agonists), and its DPP-4 resistance makes it a durable pharmacological scaffold for the GIPR arm of such combinations.
Why it’s plausible
The readme confirms (Pro3)GIP was engineered specifically for DPP-4 resistance via Pro3. Tirzepatide demonstrated that dual GLP-1R/GIPR co-agonism exceeds GLP-1R monotherapy in glycemic and weight control. If (Pro3)GIP maintains partial or full GIPR agonism in humans (compatible with ipTM 0.704 showing a credible complex), its DPP-4-stable scaffold could inform next-generation co-agonist peptide designs without the liability of rapid N-terminal cleavage.
Why it matters
A DPP-4-stable GIPR agonist scaffold could anchor the GIPR arm of incretin combination drugs, potentially matching or exceeding tirzepatide efficacy in type 2 diabetes and obesity without the need for fatty-acid conjugation strategies used in current drugs.
Plausibility.60
Novelty.45
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
noteReadme confirms Pro3 completely blocks DPP-4 cleavage at the primary site, creating a stable circulating form.
[2]
structureipTM 0.704 indicates a plausible GIPR binding pose is achievable despite N-terminal modification.
[3]
paper
Drucker et al. review establishing GIP and GLP-1 as the principal incretin hormones, providing the clinical rationale for GIPR-targeting.
doi: 10.1146/annurev-physiol-021113-170317
openupdated 2026-06-11

Could a longer-lasting GIP receptor agonist help strengthen bone, given GIP's documented actions on bone cells?

GIP is already known to act on bone-forming and bone-resorbing cells through its receptor, so a DPP-4-resistant agonist is a plausible candidate to explore for bone loss, pending direct testing.

The hypothesis
GIP(Pro3) may suppress bone resorption and support bone formation through GIPR signaling in osteoblasts and osteoclasts, independently of its pancreatic effects, and its DPP-4 resistance would give it a longer anabolic window in bone tissue than native GIP.
Why it’s plausible
GIP has documented bone-anabolic and anti-resorptive actions via GIPR expressed in osteoblasts and osteoclasts, effects that are clinically relevant since GIP receptor polymorphisms correlate with fracture risk. Native GIP's 7-minute half-life limits bone exposure; the Pro3 analog's DPP-4 resistance extends this. The GIPR target annotation aligns with known receptor expression in bone. A stable GIPR agonist could thus have repurposing potential in osteoporosis independent of its incretin action.
Why it matters
If GIP(Pro3) maintains bone GIPR agonism with enhanced stability, it could serve as a proof-of-concept scaffold for non-incretin GIPR-targeted osteoporosis drugs, a largely unexplored area with high unmet need particularly in postmenopausal and diabetic patients who have overlapping bone fragility.
Plausibility.55
Novelty.50
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
noteReadme confirms DPP-4 resistance of Pro3 substitution, extending half-life relative to native GIP.
[2]
paper
Drucker et al. review covers GIPR biology including bone anabolic actions as part of incretin receptor pleiotropic effects.
doi: 10.1146/annurev-physiol-021113-170317
[3]
sequenceThe full 42-residue sequence matches native GIP except at position 3, preserving all receptor-contact residues relevant to GIPR in bone.
openupdated 2026-06-11

What makes this one amino-acid swap produce near-full activation at the human receptor but only partial activation at the rodent one?

Pinning down the structural basis would tell researchers when rodent results for this compound can, and cannot, be trusted for human work.

The hypothesis
The Pro3 substitution in GIP(Pro3) alters the N-terminal helical conformation of the peptide such that it binds the human GIPR extracellular domain with fundamentally different receptor activation dynamics compared to the rodent GIPR, explaining the divergent pharmacology observed in 2016.
Why it’s plausible
The readme notes that pharmacology at the human GIPR differs fundamentally from rodent data. The N-terminus of class B GPCR ligands is critical for receptor activation. Replacing Glu3 with Pro introduces a helix-breaking residue in the first turn, which could selectively perturb contacts with the human GIPR ECD that are conserved differently in rodents. The moderate ipTM of 0.704 with pLDDT 54.5 suggests the N-terminal region is disordered in the complex, consistent with species-specific conformational sensitivity.
Why it matters
If confirmed, the Pro3 change does not merely block DPP-4 but actively reshapes receptor engagement in a species-specific way, meaning rodent-derived GIPR pharmacology data from (Pro3)GIP cannot be extrapolated to humans, with implications for GIPR-targeted drug design.
Plausibility.55
Novelty.40
Impact.60
Basis · grounding1 paper · 3 computed/notes
[1]
noteReadme states a key 2016 study showed pharmacology at human GIPR is fundamentally different from rodent work implied.
[2]
sequencePosition 3 is P (proline, helix-breaker) in the sequence YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ.
[3]
structurepLDDT 54.5 indicates low-confidence/disordered N-terminal region in the modeled GIPR complex.
[4]
paper
2016 study on human GIPR pharmacology of (Pro3)GIP from University of Copenhagen group.
doi: 10.1111/bph.13323
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7040446400642395 openfold3-mlx
ranking score 0.7799080610275269 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.745global PDE — lower = better
disorder0.148fraction disordered
chain pair ipTM (A, B)0.704interface quality
3-letter notation
Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime453s
predicted bymlx@peptide
predicted at2026-04-22
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). Longer-lasting gut insulin signal (GIP Pro3 analog) (pep-10772, v1). PeptideModel. https://peptidemodel.com/card/pep-10772
@peptide{pep10772,
  sequence = {YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 5 by signal overlap
clinical trials 810 on ct.gov · 34 on EUCTR · checked 2026-05-09
ct.gov trials ? 810
with results 43
EUCTR 34
by phase
1phase 12phase 37no phase
by status
5completed1recruiting2active1terminated1unknown
references 7 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use