pe
pep-10906 v1 CC-BY-SA-4.0

CT-388: experimental obesity & type 2 diabetes drug (Roche/Genentech)

A once-weekly injectable being tested for weight loss and type 2 diabetes; it activates two gut hormones at once, like Ozempic but targeting both GLP-1 and GIP pathways. Experimental, not yet an approved drug.

statuscomputed targetGIPR length33 aa refs2
status 2 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.788
pTM0.722
avg pLDDT51.7
ranking score0.847
STRUCTURE · PEP-10906 × GIPR
ranking0.847
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence33 aa
15101520253033
HAEGTFTSDVS SYLEGQAAKEF IAWLVKGRSSX
in the news 33 articles
overview readme

What this is

CT-388 (also designated RO7795068) is an investigational once-weekly injectable medication being studied for obesity and type 2 diabetes. It activates two gut-hormone receptors at once — the GLP-1 receptor and the GIP receptor — making it a "dual agonist" in the same class as tirzepatide. CT-388 is developed by Roche/Genentech and is not approved by the FDA or any regulatory authority; it is only available to participants in Roche-sponsored clinical trials.

What sets CT-388 apart from tirzepatide is how it engages those two receptors: it is engineered for balanced, equal activation of both GLP-1R and GIPR, whereas tirzepatide favors the GIP receptor by roughly 9:1. CT-388 is also designed with cAMP-biased signaling — a property intended to reduce receptor desensitization over time by minimizing β-arrestin recruitment at both receptors. The stored raw sequence (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRSSX) is a representative approximation; the full chemistry of the active compound, including any modifications supporting its approximately one-week half-life, has not been disclosed in published literature.


History

CT-388 originated at Carmot Therapeutics, a California-based biotech founded around a platform for engineering peptide multi-receptor agonists with biased signaling profiles (Madsbad and colleagues, Expert Opinion on Investigational Drugs 2025). The molecule was conceived as a deliberate pharmacologic response to tirzepatide's characterized limitations: its imbalanced approximately 9:1 GIP-over-GLP-1 receptor engagement and β-arrestin-driven receptor desensitization, which had been documented in the literature (Willard and colleagues, JCI Insight 2020). Carmot advanced CT-388 through Phase 1 and into Phase 2 before Roche acquired the company in December 2023 for $2.7 billion upfront, with CT-388 — renamed RO7795068 — as the central asset. Roche reported 48-week Phase 2 data in early 2026 and announced the Phase 3 ENITH program.


What it does

CT-388 works by mimicking two gut hormones simultaneously. Activating the GLP-1 receptor suppresses appetite, slows stomach emptying, and stimulates insulin release in proportion to blood sugar levels. Activating the GIP receptor adds an additional boost to the postprandial insulin response and may improve how the body handles fats. Together, these effects reduce food intake and lower blood sugar — the same combination that drives weight loss with tirzepatide.

The added design feature is biased signaling: CT-388 is engineered to preferentially trigger the cAMP-mediated pathway at both receptors while minimizing the β-arrestin pathway, which is associated with receptor internalization and loss of response over time. In preclinical models, the biased-agonism design produced dose-dependent weight reduction, glycemic improvement, and improved metabolic liver pathology (Rodriguez and colleagues, Cell Reports Medicine 2025).


Evidence

  • Human: Phase 1 in adults with obesity (including a type 2 diabetes cohort) demonstrated dose-dependent weight loss and glycemic improvement; in the Phase 1b T2D cohort at the 22 mg dose, 50% of participants reached HbA1c below 5.7% (diabetes remission threshold) at approximately 12 weeks (Madsbad and colleagues, Expert Opinion on Investigational Drugs 2025). Phase 2 CT-388-103 (469 adults with obesity, 48 weeks) reported 22.5% placebo-adjusted weight loss at the 24 mg dose (efficacy estimand; 18.3% by treatment-regimen estimand); 87% of participants achieved ≥10% weight loss and 47.8% achieved ≥20%; no weight-loss plateau was observed at study end; treatment-related discontinuation was 5.9%; 73% of prediabetic participants in the CT-388 arm achieved normal blood glucose versus 7.5% in the placebo arm (Madsbad and colleagues, Expert Opinion on Investigational Drugs 2025). A separate Phase 2 trial in approximately 360 adults with type 2 diabetes (CT-388-104) was ongoing at published research date with results not yet available. Phase 3 ENITH1 and ENITH2 were announced to begin Q1 2026; no Phase 3 results were available at published research date.
  • Animal: Preclinical studies in rodents and non-human primates showed dose-dependent weight reduction, improved glycemic control, and improved metabolic-associated steatohepatitis (MASH) pathology. The cAMP-biased, β-arrestin-sparing design of dual GLP-1R/GIPR agonists was independently characterized and shown to yield greater glucose-lowering and weight-loss efficacy in preclinical models compared with non-biased agonism (Rodriguez and colleagues, Cell Reports Medicine 2025).
  • In vitro: Receptor binding, cAMP-biased signaling, and reduced β-arrestin recruitment were characterized in preclinical assay systems. Spatiotemporal GLP-1R and GIPR signaling and trafficking dynamics induced by dual agonists have been described in the literature (Gasbjerg and colleagues, Physiological Reviews 2026).

Known effects

  • Weight loss in adults with obesity — Phase 2 human evidence (single 469-patient trial, 48 weeks; Phase 3 not completed)
  • Glycemic improvement in type 2 diabetes — Phase 1b human evidence (small T2D cohort; dedicated Phase 2 T2D trial results pending)
  • Prediabetes glycemic normalization — Phase 2 (73% of prediabetic participants reached normal blood glucose at 48 weeks vs 7.5% placebo)
  • Metabolic liver improvement (MASH) — Preclinical only (rodent and non-human primate models)
  • Reduced receptor desensitization vs. standard dual agonism — Mechanistic/preclinical; clinical translation not yet confirmed

Safety signals

Available safety data derive from Phase 1 and Phase 2 CT-388-103 (469 patients, 48 weeks). The safety profile at available follow-up appears consistent with the GLP-1 receptor agonist class:

  • Nausea, vomiting, diarrhea — class-typical gastrointestinal adverse events; described in available sources as mostly mild to moderate, predominantly occurring during the dose-escalation phase
  • Decreased appetite — pharmacologically expected from GLP-1R agonism; also part of the intended mechanism
  • Treatment-related discontinuation — reported at 5.9% in the 24 mg arm of Phase 2 CT-388-103

The following safety questions remain unanswered because they require multi-year exposure data not yet generated:

  • Long-term safety beyond 48 weeks — pancreatitis, gallbladder disease, retinopathy progression, and rare oncologic signals (all identified as Phase 3 unknowns in available literature)
  • Cardiovascular outcomes — no cardiovascular outcomes trial has been conducted; MACE-reduction signals documented with semaglutide and tirzepatide do not automatically transfer to CT-388
  • Medullary thyroid carcinoma and MEN2 — expected to be labeled contraindications based on the C-cell tumor signal observed across the GLP-1R agonist class in rodent carcinogenicity studies, but CT-388 has no approved label
  • Effects in pregnancy and lactation — no human data; available sources describe these as precautionary contraindications consistent with the incretin class

Regulatory status

  • US (FDA): Not approved — investigational. Legally administered only to participants in authorized Roche-sponsored clinical trials. Per published sources, not legally compoundable under US 503A or 503B pathways.
  • International: Not approved in any jurisdiction. Trial sites span North America, Europe, and other regions; no commercial availability.
  • WADA: Not explicitly listed by name on the WADA Prohibited List at published research date. Per available sources, CT-388 falls under WADA S0 (substances not approved by any government regulatory health authority for human therapeutic use). S2 (peptide hormones, growth factors, related substances) is described as the expected classification upon future approval.

Myths and misconceptions

  • "CT-388 is available through compounding pharmacies" — No. CT-388 is an investigational Roche product not approved by any regulatory authority and not legally compoundable in the US under 503A or 503B pathways. Anything offered under the CT-388 or RO7795068 name outside a Roche-sponsored trial is not the clinical-grade molecule and cannot be assumed to share its sequence, purity, or pharmacology.
  • "CT-388's 22.5% Phase 2 weight loss proves it is more effective than tirzepatide" — Not established. Cross-trial comparisons against tirzepatide's SURMOUNT-1 results use different patient populations, trial durations, estimands, and titration schemes. The Phase 2 number is genuinely strong and the weight-loss curve had not plateaued at 48 weeks, but a fair efficacy comparison requires a head-to-head trial that has not been conducted.
  • "Biased agonism is a marketing concept; receptor pharmacology doesn't matter" — Signaling bias is a well-characterized pharmacologic phenomenon; tirzepatide's imbalanced, GIP-favoring profile is documented in peer-reviewed literature (Willard and colleagues, JCI Insight 2020). Whether CT-388's specific design choices produce a clinically meaningful difference in durability or tolerability is an empirical question Phase 3 is designed to answer.

Mechanism

CT-388 is a unimolecular peptide-based dual agonist of the glucagon-like peptide-1 receptor (GLP-1R) and the glucose-dependent insulinotropic polypeptide receptor (GIPR). GLP-1R agonism drives glucose-dependent insulin secretion, suppresses glucagon, activates hypothalamic satiety pathways, and slows gastric emptying. GIPR agonism potentiates the postprandial insulin response and may improve lipid metabolism. This receptor combination is the same mechanistic class as tirzepatide.

CT-388 is distinguished from tirzepatide by two specific design properties. First, balanced equimolar receptor engagement: tirzepatide's receptor potency is approximately 9:1 GIP-over-GLP-1 biased (Willard and colleagues, JCI Insight 2020); CT-388 is designed for parity at both receptors. Second, cAMP signal-biased activation with minimal β-arrestin recruitment at both GLP-1R and GIPR. β-arrestin-mediated receptor internalization is a recognized driver of receptor desensitization and tachyphylaxis in peptide GPCR pharmacology. The biased-agonism design is intended to reduce receptor downregulation and sustain pharmacologic activity over time. Preclinical characterization of dual GLP-1R/GIPR biased agonism is described in Rodriguez and colleagues (Cell Reports Medicine 2025), which showed greater efficacy versus non-biased dual agonism in animal models.

Whether these design differences translate into clinically superior durability or efficacy versus tirzepatide remains an open question. Phase 2 results are consistent with the mechanistic hypothesis; a direct head-to-head trial has not been conducted.

The approximately one-week half-life enabling once-weekly dosing is reported in available sources; the structural modifications (conjugation or formulation strategy) responsible for extended half-life are not individually disclosed in published literature.


Open questions

  • Phase 3 efficacy confirmation: Whether the 22.5% Phase 2 weight-loss result will replicate in the Phase 3 ENITH1 and ENITH2 trials at the scale and population diversity required for regulatory approval. Single Phase 2 trials in obesity have historically been variable.
  • Biased agonism clinical translation: Whether cAMP-biased, β-arrestin-sparing dual agonism produces a measurably superior durability or efficacy outcome versus tirzepatide in a controlled comparison. The preclinical mechanistic case is characterized as strong in available literature (Rodriguez and colleagues, Cell Reports Medicine 2025); Phase 3 data are required to confirm clinical translation.
  • Cardiovascular outcomes: No cardiovascular outcomes trial has been conducted. Whether CT-388 will replicate the MACE-reduction signals documented with semaglutide and tirzepatide is not established, and a dedicated CVOT may be required prior to broad approval.
  • Long-term safety beyond 48 weeks: Pancreatitis, gallbladder disease, retinopathy progression, and rare oncologic signals require multi-year exposure data not yet generated by the development program.
  • Phase 2 T2D outcome: CT-388-104 (~360 T2D patients) was ongoing at published research date; T2D-specific efficacy and HbA1c endpoint results are not reported.
  • Body composition: Sub-studies on lean mass preservation, bone density, and effects of resistance training during CT-388-induced weight loss are not yet published — a gap shared with the broader incretin class.
  • Head-to-head comparison: All current efficacy comparisons with tirzepatide and retatrutide are cross-trial, with different populations, estimands, titration schemes, and durations. No prospective head-to-head trial exists at published research date.
  • Combination strategies: CT-388 in combination with complementary agents (such as petrelintide, an amylin analog also in the Roche obesity pipeline) is noted as a potential development direction; no combination clinical evidence exists at published research date.

Related peptides

  • Tirzepatide — FDA-approved dual GLP-1R/GIPR agonist; CT-388's closest pharmacologic predecessor and benchmark for cross-trial comparison, distinguished by its approximately 9:1 GIP-over-GLP-1 receptor bias
  • Retatrutide — triple GLP-1R/GIPR/GCGR agonist from Eli Lilly; Phase 2 results in the same efficacy range as CT-388, used as a cross-trial comparator
  • Semaglutide — GLP-1R-only agonist (Ozempic, Wegovy); the established clinical benchmark for GLP-1 class weight loss and cardiovascular outcomes
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does CT-388 activate its two target receptors equally in all relevant tissues (fat, pancreas, brain), or does the balance shift depending on where in the body it acts?

If the balance varies by tissue, drug developers could optimize dosing strategies to favor brain effects (appetite reduction) or fat effects (lipid mobilization) in different patients, enabling more personalized obesity treatment.

The hypothesis
The ipTM=0.79 prediction for CT-388 against GIPR reflects high-confidence docking at the GIPR extracellular domain alone, but CT-388's balanced 1:1 GLP-1R/GIPR activation in a dual-receptor context requires a conformational switch in the transmembrane region that is not captured by static extracellular docking predictions, and the actual on-cell potency balance deviates from cell-free binding affinity ratios in a membrane-composition-dependent manner.
Why it’s plausible
The openfold3 ipTM=0.79 for this sequence against GIPR is among the higher values in this peptide set, indicating confident extracellular interface prediction. However, dual agonism at a 1:1 receptor ratio is a kinetic and conformational property of the full transmembrane receptor context, not just extracellular binding. GLP-1R and GIPR share class B GPCR architecture but have distinct transmembrane helix arrangements; a peptide engineered for balanced activation must tune both extracellular binding and transmembrane coupling, which vary with membrane cholesterol, ganglioside content, and co-receptor expression. Pancreatic beta cells, adipocytes, and neurons have distinct membrane compositions and receptor expression ratios, meaning CT-388's 1:1 balance may hold in one tissue but not others.
Why it matters
If CT-388's 1:1 balance is cell-type-specific rather than universal, the drug's pharmacology in brain (appetite suppression) versus pancreas (insulin sensitization) versus adipose (fat mobilization) may differ substantially from the intended balanced profile, with implications for tissue-specific dose optimization.
Plausibility.70
Novelty.50
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
structureipTM=0.788 for CT-388/GIPR complex, high confidence at extracellular interface, but transmembrane coupling not modeled
[2]
noteCT-388 engineered for balanced 1:1 GLP-1R/GIPR activation, distinguished from tirzepatide's 9:1 ratio, but the balance metric is not cell-type resolved
[3]
paper
Mutagenesis data for class B GPCRs shows that affinity and potency can diverge substantially depending on receptor context and membrane environment
doi: 10.1124/pr.115.011395
openupdated 2026-06-05

Could CT-388 reverse liver scarring in metabolic fatty liver disease by directly activating a receptor on liver cells, separate from its weight-loss effect?

If true, it would make CT-388 relevant to fatty liver disease, which affects 1 in 4 adults globally and has no approved injectable treatment, potentially giving patients a single drug that addresses both obesity and its most dangerous liver complication.

The hypothesis
CT-388's balanced GLP-1R/GIPR dual agonism would produce superior hepatic steatosis reversal compared to GLP-1R agonists alone, because GIPR activation on hepatocytes and hepatic stellate cells provides an additive anti-fibrotic signal through cAMP-dependent suppression of TGF-beta signaling that is absent from GLP-1R agonist monotherapy.
Why it’s plausible
GLP-1R agonists reduce hepatic steatosis primarily through weight loss and indirect insulin sensitization. GIPR is expressed on hepatic stellate cells and hepatocytes, and GIP signaling in the liver has been linked to lipid metabolism regulation. If cAMP elevation via GIPR on hepatic stellate cells suppresses TGF-beta-mediated fibrogenic signaling (a known cAMP effect in stellate cells), CT-388's balanced GIPR activation would provide a direct anti-fibrotic hepatic component absent from tirzepatide's heavily GIP-weighted but non-cAMP-biased profile at the same total receptor activation. NASH/MASH is a major comorbidity of the obesity population CT-388 targets.
Why it matters
Demonstrating a GIPR-mediated hepatic anti-fibrotic effect from cAMP-biased signaling would establish CT-388 as a candidate for metabolic-associated steatohepatitis (MASH) beyond its obesity indication, addressing the large MASH market with no approved injectable peptide.
Plausibility.60
Novelty.55
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
paper
CT-388 is in obesity and type 2 diabetes trials; MASH is an unaddressed comorbidity in these populations that GIPR hepatic signaling could target
doi: 10.1080/13543784.2025.2472408
[2]
notecAMP-biased signaling at both receptors is the designed property; cAMP suppresses TGF-beta signaling in hepatic stellate cells by known mechanisms
[3]
paper
Class B GPCR transmembrane coupling context, relevant to cAMP signal magnitude in hepatocyte and stellate cell membrane environments
doi: 10.1111/j.1476-5381.2011.01525.x
openupdated 2026-06-05

Does CT-388 avoid the gradual weakening of GIP receptor response that may limit tirzepatide's long-term effectiveness?

If true, patients on CT-388 might continue losing weight at months 6-12 when those on tirzepatide plateau, potentially achieving greater total weight loss without requiring dose escalation, which matters enormously to the hundreds of millions of people with obesity.

The hypothesis
CT-388's cAMP-biased signaling at GIPR, achieved by minimizing beta-arrestin recruitment, prevents GIP receptor desensitization specifically in adipose tissue where chronic hyperinsulinemia and high GIPR expression cause tachyphylaxis to native GIP, thereby sustaining adipose-tissue GIP responsiveness throughout the dosing interval and producing greater fat-mass reduction per unit receptor activation than tirzepatide's GIP-favoring but non-biased profile.
Why it’s plausible
The readme states that CT-388 is engineered for cAMP-biased signaling to reduce receptor desensitization by minimizing beta-arrestin recruitment at both receptors, and that tirzepatide's approximately 9:1 GIP-over-GLP-1 imbalance and beta-arrestin-driven receptor desensitization were the characterized limitations CT-388 was designed to overcome. Adipose tissue expresses high GIPR, and GIP-mediated adipocyte signaling is acutely sensitive to desensitization in the setting of sustained GIP receptor agonism. If arrestin-independent cAMP signaling at GIPR is more resistant to agonist-driven downregulation than arrestin-dependent pathways, CT-388 would maintain adipose GIP signaling at week 12 when tirzepatide's effect would have waned via GIPR internalization.
Why it matters
This would provide the mechanistic basis for CT-388's potential superiority over tirzepatide in fat-mass reduction specifically, and would predict that the week-12 to week-24 treatment response gap between CT-388 and tirzepatide would widen progressively rather than remaining constant.
Plausibility.65
Novelty.50
Impact.65
Basis · grounding2 papers · 1 computed/note
[1]
paper
CT-388 conceived as pharmacological response to tirzepatide's imbalanced GIP/GLP-1 engagement and beta-arrestin-driven desensitization
doi: 10.1080/13543784.2025.2472408
[2]
noteCT-388 engineered for cAMP-biased signaling to reduce receptor desensitization by minimizing beta-arrestin recruitment at both GLP-1R and GIPR
[3]
paper
Receptor-level pharmacology data showing that mutations affecting agonist affinity versus potency diverge, consistent with distinct signal pathway contributions to functional outcomes
doi: 10.1124/pr.115.011395
openupdated 2026-06-05

Does the long-acting chemical modification of CT-388 shift which receptor it prefers depending on whether it is in the blood or in tissue?

If true, it would mean that carefully tuning where and how CT-388 is modified could allow engineers to precisely control whether the drug preferentially curbs appetite (brain, GLP-1R) or burns fat (adipose, GIPR), enabling a more targeted obesity drug than any currently available.

The hypothesis
The undisclosed modification supporting CT-388's approximately one-week half-life involves a fatty-acid acylation at a lysine residue within the GRSSX C-terminal region that enables albumin binding, and this acyl tether reduces GLP-1R activation relative to GIPR at high albumin concentrations by sterically masking the GLP-1R-selective N-terminal helix more than the GIP receptor contact region, meaning the therapeutic 1:1 balance holds only within a narrow albumin-concentration window relevant to the interstitial rather than plasma compartment.
Why it’s plausible
The readme states that the full chemistry supporting the approximately one-week half-life has not been disclosed, but the GRSSX C-terminal motif with an uncertain last residue (X) is consistent with a C-terminal acylation site. Semaglutide and cagrilintide both achieve long half-life through C18 fatty diacid-albumin binding; a similar strategy for CT-388 would make pharmacological sense. Fatty-acid acyl groups on GLP-1 analogs are known to sterically interact with the receptor N-terminus binding domain. If the acyl group in CT-388 preferentially screens the GLP-1R helical contact over the GIPR contact, the 1:1 balance would shift toward GIPR dominance at high albumin concentrations (plasma) and toward GLP-1R at low albumin (interstitium, CNS).
Why it matters
If the acylation creates a compartment-dependent potency imbalance, CT-388's apparent 1:1 balance measured in cell assays would not translate uniformly to all tissue pharmacologies, and the drug's differentiation claim from tirzepatide would require tissue-specific validation.
Plausibility.50
Novelty.55
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
noteFull chemistry including modifications supporting approximately one-week half-life has not been disclosed; C-terminal X residue in stored sequence is consistent with a modified amino acid or acylation site
[2]
sourcePlasma clearance and half-life data for peptide half-life extension mechanisms provide pharmacokinetic benchmark for albumin-binding strategies
[3]
paper
CT-388 designed for approximately one-week half-life with balanced GLP-1R/GIPR activation; modification chemistry is the unknown variable
doi: 10.1080/13543784.2025.2472408
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7878170013427734 openfold3-mlx
ranking score 0.84688401222229 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.736global PDE — lower = better
disorder0.144fraction disordered
chain pair ipTM (A, B)0.788interface quality
3-letter notation
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Ser-Ser-X
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weights
hardware
mlx version
python
random seed
msa strategy
diffusion samples1
runtime580s
predicted bymlx@peptide
predicted at2026-05-03
citationbibtex
peptidemodel (2026). CT-388: experimental obesity & type 2 diabetes drug (Roche/Genentech) (pep-10906, v1). PeptideModel. https://peptidemodel.com/card/pep-10906
@peptide{pep10906,
  sequence = {HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRSSX},
  target   = {gipr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 4 by signal overlap
clinical trials 5 on ct.gov · checked 2026-05-09
ct.gov trials 5
PubMed RCT 1
by phase
1phase 12phase 22phase 3
by status
2completed2recruiting1active
references 2 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use