pe
pep-10924 v1 CC-BY-SA-4.0

Eloralintide (ZP4207): once-weekly weight-loss injection for obesity

An experimental once-weekly injection that mimics amylin, a hormone that signals fullness after meals, to help people with obesity lose weight; not yet an approved drug.

statuscomputed targetCALCR length38 aa refs1
snapshot clinical 0% confidence
Class
Selective amylin receptor agonist (long-acting, once-weekly)
Status
Investigational — no regulatory approval in any jurisdiction; Phase 3 enrollment began late 2025
Best-supported effect
Dose-dependent body-weight reduction in overweight and obese adults (up to ~20% at 48 weeks in Phase 2 RCT); cardiometabolic marker improvements across all studied doses (human)
Main caveat
Phase 3 data are not yet available; long-term safety beyond 48 weeks is uncharacterized; no cardiovascular outcomes trial has been conducted; all eloralintide-specific human evidence is from a single sponsor
status 2 / 5
prediction metrics boltz-2 2.2.1
ipTM0.867
pTM0.797
avg pLDDT82.6
ranking score0.834
STRUCTURE · PEP-10924 × CALCR
ranking0.834
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence38 aa
1510152025303538
KCNTATCATQRLANFLVHS SNNFGPILSSTNVGSNTYQ
in the news 20 articles
overview readme

What this is

Eloralintide (also called LY3841136) is an investigational once-weekly injection being developed by Eli Lilly as a weight-loss medication for adults with overweight or obesity. It mimics amylin, a hormone that the pancreas releases alongside insulin after meals to signal fullness and slow stomach emptying. Eloralintide is engineered to act selectively on amylin receptors while largely sparing the closely related calcitonin receptor — a selectivity profile intended to improve tolerability over the first-generation amylin analog pramlintide. It is not approved in any jurisdiction; Phase 3 enrollment began in late 2025 (Billings et al., Lancet 2025).

The stored 38-letter sequence (KCNTATCATQRLANFLVHSSNNFGPILSSTNVGSNTYQ) shows the amylin backbone only — the active drug is a 37-residue C-terminally amidated peptide in which Cys2 and Cys7 are joined by a non-reducible methylene thioacetal bridge (a mimic of the native disulfide) and Lys26 is acylated with a γ-Glu-γ-Glu spacer terminating in a C20 fatty diacid, the modification that reversibly binds serum albumin and gives the drug its roughly two-week half-life (Briere et al., Molecular Metabolism 2025). None of those modifications are visible in the raw letter sequence.

History

Eloralintide came out of an Eli Lilly medicinal-chemistry program aimed at overcoming the limitations of pramlintide — the first amylin analog (FDA-approved in 2005), whose mealtime injection schedule, mixed amylin/calcitonin receptor activity, and amyloid-aggregation tendency limited clinical uptake. The discovery work was published as a translational discovery-to-clinical-proof-of-concept report by Briere and colleagues in Molecular Metabolism (2025), describing the medicinal chemistry that yielded a peptide preferentially activating the human amylin 1 receptor (AMY1R) roughly 12-fold over the calcitonin receptor, with a C20 fatty-diacid acylation supporting once-weekly subcutaneous dosing.

The 12-week Phase 1 multiple-ascending-dose study was published by Bhattachar and colleagues in Diabetes, Obesity and Metabolism (2026), and the 48-week Phase 2 randomized controlled trial — 263 adults with overweight or obesity across 46 US sites — was published by Billings and colleagues in the Lancet (2025) and presented simultaneously at ObesityWeek 2025. Phase 3 enrollment was announced in late 2025. A Phase 2 combination study with tirzepatide (/card/pep-00017) is ongoing.

What it does

Eloralintide mimics amylin's natural role: it signals satiety to the brain, suppresses postprandial glucagon, and slows gastric emptying — all of which lower overall calorie intake. In the 48-week Phase 2 trial, participants on eloralintide lost roughly 9.5% (1 mg/week), 12% (3 mg/week), 18% (6 mg/week), and 20% (9 mg/week) of body weight versus about 0.4% on placebo, with cardiometabolic markers (waist circumference, blood pressure, lipid profile, glycemic control) improving across all active doses (Billings et al., Lancet 2025). The 12-week Phase 1 study had previously shown dose-proportional pharmacokinetics and a 2.6–11.3% weight-loss signal across dose levels in 100 participants (Bhattachar et al., Diabetes, Obesity and Metabolism 2026).

The mechanism operates on a pathway distinct from GLP-1 and GIP signaling used by semaglutide (/card/pep-00016) and tirzepatide (/card/pep-00017), which is why amylin agonism is being explored both as a standalone weight-loss strategy and as a partner for the GLP-1 class.

Evidence

  • Human: One Phase 1 multiple-ascending-dose study (n=100, 12 weeks; Bhattachar et al., Diabetes, Obesity and Metabolism 2026) and one Phase 2 RCT (n=263, 48 weeks, 46 US sites; Billings et al., Lancet 2025). Phase 3 enrollment began late 2025; no Phase 3 results available. A Phase 2 combination study with tirzepatide is ongoing with no published results. All eloralintide-specific human evidence derives from Lilly-sponsored programs; independent replication has not occurred.
  • Animal and in vitro: The discovery-to-clinical-proof-of-concept paper (Briere et al., Molecular Metabolism 2025) characterizes receptor pharmacology — eloralintide preferentially activated human AMY1R about 12-fold over the calcitonin receptor and 11-fold over AMY3R in vitro — and describes the preclinical optimization that supported clinical entry.

Myths and misconceptions

  • "Eloralintide is available now through compounding pharmacies." No. Eloralintide is investigational and not approved in any jurisdiction. Anything offered under the eloralintide or LY3841136 name outside a Lilly-sponsored clinical trial is not the investigational drug and cannot be assumed to share its sequence, receptor selectivity, or pharmacokinetics. Its design — including the methylene-thioacetal bridge and C20 diacid acylation on Lys26 — is sequence- and chemistry-dependent and would not survive arbitrary third-party reproduction.
  • "Eloralintide produces weight loss without side effects, unlike GLP-1 drugs." Partially true at best. Phase 2 data show a tolerability profile distinct from GLP-1 agonists — fatigue is prominent at the higher doses — but nausea remained common in the 6 mg and 9 mg arms and was dose-dependent across the trial (Billings et al., Lancet 2025). Tolerability is improved relative to pramlintide on certain axes, but the drug is not side-effect-free.
  • "Eloralintide and pramlintide are essentially the same drug." No. Pramlintide is a mealtime injection co-administered with insulin for glycemic control; eloralintide is a once-weekly standalone agent being developed for obesity. Pramlintide co-activates calcitonin receptors; eloralintide is selectivity-engineered for AMY1. The two differ in sequence, half-life, receptor pharmacology, dosing schedule, and target indication (Briere et al., Molecular Metabolism 2025).
  • "Because amylin is 'natural,' eloralintide is safer than semaglutide." Not established. Eloralintide is a synthetic engineered analog with backbone modifications and a fatty-acid conjugation; it is no more inherently "natural" than semaglutide. Safety is an empirical question answered by trial data, not by biological lineage.

Common questions

How does eloralintide differ from semaglutide and tirzepatide? Semaglutide acts on GLP-1 receptors; tirzepatide acts on both GLP-1 and GIP receptors. Eloralintide acts on amylin receptors — a distinct receptor system that converges on satiety and metabolic regulation through different signaling. That non-overlap is why Lilly is also studying eloralintide in combination with tirzepatide: the mechanisms are intended to be additive rather than redundant.

How does eloralintide compare to pramlintide (Symlin)? Pramlintide requires injection with every meal, co-activates both amylin and calcitonin receptors, and is approved for glycemic control in insulin-treated diabetes. Eloralintide is once-weekly, selective for amylin receptors over the calcitonin receptor, and is being developed for obesity. They share an amylin lineage but differ substantially in pharmacology, dosing, and intended use.

When might eloralintide be available? Phase 3 enrollment began in late 2025. If Phase 3 succeeds and regulatory review proceeds on a standard timeline, approval would not be expected before 2028–2029 at the earliest.

Known effects

  • Body-weight reduction in overweight or obese adults — Phase 2 (48 weeks, n=263): roughly 9.5%, 12%, 18%, and 20% mean reduction at 1, 3, 6, and 9 mg per week versus 0.4% on placebo (Billings et al., Lancet 2025).
  • Cardiometabolic marker improvement — Phase 2: improvements in waist circumference, blood pressure, lipid profiles, and glycemic control across all active doses (Billings et al., Lancet 2025).
  • Early weight-loss signal — Phase 1 (12 weeks, n=100): 2.6–11.3% weight reduction across dose levels with dose-proportional pharmacokinetics (Bhattachar et al., Diabetes, Obesity and Metabolism 2026).
  • Satiety and gastric slowing — expected pharmacological effect of amylin receptor agonism; decreased appetite reported as an adverse event in Phase 2 (Billings et al., Lancet 2025).

Safety signals

Nausea was dose-dependent across Phase 1 and Phase 2, more common at the 6 mg and 9 mg arms and reduced by slower titration (Billings et al., Lancet 2025; Bhattachar et al., Diabetes, Obesity and Metabolism 2026). Fatigue was prominent in Phase 2, particularly at the higher doses — a notable point of difference from the GLP-1 class, where nausea tends to be the dominant tolerability axis (Billings et al., Lancet 2025). Decreased appetite and headache were also reported in Phase 2. Long-term safety beyond 48 weeks has not been characterized; Phase 3 will be the first multi-year dataset. No cardiovascular outcomes trial has been conducted. Effects on bone density, lean-mass preservation, and pancreatic health are not addressed in the Phase 1 or Phase 2 publications. The safety profile of eloralintide in combination with tirzepatide is undefined pending the ongoing Phase 2 combination data. Cautions extending from the pramlintide class precedent — slowed gastric emptying altering absorption of orally administered drugs, and elevated hypoglycemia risk when combined with insulin or insulin secretagogues — apply by analogy; eloralintide-specific drug-interaction studies have not been conducted.

Regulatory status

  • US (FDA): Not approved. Investigational; legally available only to participants in Lilly-sponsored clinical trials. Not legally available through compounding pharmacies, telehealth platforms, or research-chemical suppliers.
  • International: Not approved in any jurisdiction; no commercial availability.
  • WADA: Not listed by name; as a non-approved substance it is covered by S0 (substances not approved by any government regulatory health authority for human therapeutic use). As a peptide hormone analog it would be expected to fall under S2 upon approval. Athletes subject to WADA-aligned codes should treat eloralintide as prohibited in and out of competition.

Mechanism

Eloralintide is a selective agonist of the amylin receptor family — AMY1, AMY2, and AMY3 — which are heterodimers of the calcitonin receptor (CTR) with receptor activity-modifying proteins RAMP1, RAMP2, and RAMP3 respectively. Pramlintide and native amylin engage both amylin receptors and the bare calcitonin receptor; eloralintide is engineered to preferentially activate AMY1R while largely sparing CTR (about 12-fold AMY1R-over-CTR potency in vitro, with comparable selectivity over AMY3R), a profile intended to reduce off-target burden (Briere et al., Molecular Metabolism 2025).

The active molecule is a 37-residue C-terminally amidated peptide carrying a methylene thioacetal bridge between Cys2 and Cys7 — a non-reducible mimic of amylin's native disulfide — and a side chain on Lys26 consisting of two γ-glutamic-acid spacers terminating in a C20 fatty diacid. The fatty acid reversibly binds serum albumin, yielding an effective half-life of roughly two weeks and supporting once-weekly subcutaneous dosing (Briere et al., Molecular Metabolism 2025). Downstream, amylin-receptor signaling in the area postrema and nucleus tractus solitarius mediates satiety, suppresses postprandial glucagon release, and slows gastric emptying — the same physiology that underlies pramlintide's effects, applied here with a selectivity-engineered and long-acting scaffold.

Open questions

  • Whether the Phase 2 weight-loss magnitude (up to roughly 20%) and tolerability profile replicate at Phase 3 scale and over multi-year exposure.
  • Whether eloralintide reduces major adverse cardiovascular events — no cardiovascular outcomes trial exists; this is the benchmark now set by semaglutide.
  • Long-term effects on bone density, lean mass, and pancreatic health beyond 48 weeks.
  • Whether combination with tirzepatide adds efficacy at acceptable tolerability cost — Phase 2 results pending.
  • Whether eloralintide's selectivity profile preserves the glycemic benefits pramlintide showed in insulin-treated T1D and T2D populations.
  • Head-to-head efficacy and tolerability versus cagrilintide (/card/pep-10997) and the GLP-1/GIP class.
  • Weight-regain dynamics after discontinuation, which have not been formally reported.
  • All eloralintide-specific human evidence derives from Lilly-sponsored programs; independent replication has not occurred.

Related peptides

  • Cagrilintide (/card/pep-10997) — the other long-acting amylin analog in late-stage obesity development (Novo Nordisk); the nearest direct competitor in the long-acting amylin class, also studied in combination with semaglutide.
  • Semaglutide (/card/pep-00016) — GLP-1 receptor agonist; the current efficacy benchmark for incretin-class weight loss and the comparator most frequently invoked for amylin agonists.
  • Tirzepatide (/card/pep-00017) — GIP/GLP-1 dual agonist; the partner molecule in the ongoing eloralintide Phase 2 combination study.
  • Retatrutide (/card/pep-00018) — investigational GIP/GLP-1/glucagon triple agonist; a competing high-efficacy Lilly obesity program working through a different receptor axis.
Hypotheses4 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could a once-weekly injection being developed for weight loss also help people resist alcohol cravings by acting on the brain's reward system through the same receptor?

Obesity and alcohol use disorder frequently occur together, and both have very limited effective treatments. A single once-weekly injection that could help with both conditions simultaneously would dramatically simplify treatment for a large number of patients and reduce the overall burden of two of the most prevalent and costly chronic diseases.

The hypothesis
Eloralintide would reduce alcohol consumption and relapse behavior in alcohol use disorder through amylin receptor-mediated modulation of mesolimbic dopamine release in the nucleus accumbens, a mechanism demonstrated for native amylin but not yet tested for the once-weekly formulation.
Why it’s plausible
Amylin receptor signaling in the nucleus accumbens and ventral tegmental area has been shown to reduce ethanol intake and preference in rodent models. This is a separate circuit from the hypothalamic satiety effect. Eloralintide's long half-life could provide continuous amylin receptor engagement in reward circuits over the weekly interval, potentially suppressing alcohol craving without the multiple daily injections that have limited clinical testing of native amylin for this indication. No data exist for once-weekly amylin analogs in alcohol use disorder models.
Why it matters
Alcohol use disorder has very few approved pharmacotherapies and extremely high relapse rates; a once-weekly injectable that simultaneously addresses obesity and alcohol use (two frequently comorbid conditions) would represent a significant clinical advance.
Plausibility.55
Novelty.65
Impact.75
Basis · grounding2 computed/notes
[1]
sourceAmylin and related neuropeptides regulate mesolimbic circuits involved in reward and addiction; amylin receptor signaling in the nucleus accumbens has been linked to reduced ethanol intake in preclinical models.
[2]
noteEloralintide's once-weekly dosing creates sustained amylin receptor occupancy over seven days, including in brain regions beyond the hypothalamic satiety circuits targeted in obesity.
openupdated 2026-06-05

Does the non-natural ring structure at one end of Eloralintide boost its potency mainly by locking the peptide into the exact shape the receptor prefers, rather than just by making it more chemically stable?

If the ring's shape, not just its stability, is what matters, chemists would know to design future amylin drugs by focusing on making the ring even more precisely shaped, potentially achieving much higher potency with smaller doses and fewer side effects.

The hypothesis
The methylene thioacetal bridge replacing the native Cys2-Cys7 disulfide in Eloralintide constrains the N-terminal ring conformation into a geometry that is more complementary to the calcitonin receptor family extracellular domain than the native disulfide, and this conformational rigidity is the primary driver of the peptide's improved receptor potency over pramlintide rather than its proteolytic stability.
Why it’s plausible
The readme states the methylene thioacetal bridge mimics the native disulfide and provides the ring structure at the N-terminus (residues 2-7). Methylene thioacetals are slightly shorter and more geometrically rigid than disulfides due to the C-S-CH2-S-C versus S-S bond angle difference. This rigidity would pre-organize the N-terminal loop for receptor engagement, reducing the entropic cost of binding. If the conformational pre-organization is the primary gain, the therapeutic benefit of the modification is conformational rather than merely chemical-stability driven.
Why it matters
Distinguishing conformational from stability contributions to potency would guide the design of next-generation amylin analogs: if rigidity drives potency, further constraining the ring by lactam or hydrocarbon stapling could further improve activity; if stability drives potency, metabolic half-life engineering would be the priority.
Plausibility.65
Novelty.55
Impact.65
Basis · grounding3 computed/notes
[1]
noteCys2-Cys7 disulfide replaced by non-reducible methylene thioacetal bridge in Eloralintide; readme cites this as a mimic of the native disulfide without specifying whether the function is stability, conformation, or both.
[2]
sequenceKCNTATCATQRLANFLVHSSNNFGPILSSTNVGSNTYQ: positions 2 and 7 (C and C) form the ring; N-terminal residues 1-9 (KCNTATCAT) form the constrained loop that is the primary receptor-contact region in calcitonin-family peptides.
[3]
structureboltz-2 ipTM=0.87 for calcitonin receptor complex: high-confidence binding, consistent with a well-organized receptor-contact geometry at the N-terminal loop.
openupdated 2026-06-05

When you combine this amylin-based drug with a GLP-1 drug like semaglutide, do patients lose twice as much weight or just a bit more than with either drug alone?

Combination drug regimens are far more expensive and may carry more side effects. If the combination only adds rather than multiplies weight loss, doctors and payers can make more informed decisions about whether the extra treatment is worth the extra cost and risk for patients.

The hypothesis
Eloralintide's once-weekly amylin receptor agonism would produce additive rather than synergistic weight loss when combined with a GLP-1R agonist because the two pathways converge on the same downstream POMC neuron population in the arcuate nucleus, and true synergy would require engagement of different post-synaptic circuits.
Why it’s plausible
Amylin receptors in the area postrema and hypothalamus produce satiety signals that project to arcuate POMC neurons. GLP-1R agonists also activate NTS-arcuate circuits converging on POMC neurons. If both pathways converge at the same POMC neuron, their combination would be limited by the ceiling activity of that neuron and would produce additive rather than synergistic appetite suppression. Combination clinical data for pramlintide plus GLP-1R agonists showed additive rather than synergistic weight loss, providing indirect support for this hypothesis.
Why it matters
Clarifying whether combination therapy is additive or synergistic for eloralintide determines whether the combination with semaglutide or tirzepatide produces proportional weight loss gains relative to cost and side effect burden, which is critical for payer and patient decision-making.
Plausibility.65
Novelty.50
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
noteEloralintide mimics amylin, a post-meal satiety signal; amylin receptors in the area postrema and hypothalamus feed into arcuate circuits that also receive GLP-1 input.
[2]
paper
GLP-1RA pipeline review discusses combination strategies for obesity; synergy versus additivity in multi-target obesity regimens is an active clinical and pharmacological question.
doi: 10.1080/13543784.2025.2472408
[3]
sourceAmylin and GLP-1 receptor signaling both project through hypothalamic circuits; convergence at POMC neuron level implies a shared downstream bottleneck.
openupdated 2026-06-05

If the oily side-chain added to Eloralintide to make it long-acting were removed, would the remaining peptide stop being selective and start activating bone-related calcitonin receptors it was designed to avoid?

If selectivity is lost when the modification degrades, the body may be exposed to calcitonin-receptor effects at the tail end of each dosing interval, which could affect bone turnover. Knowing this would help doctors understand the true safety profile and dosing limits of this drug.

The hypothesis
Eloralintide's selectivity for amylin receptors (AMY1/2/3) over the calcitonin receptor (CTR) is conferred primarily by its Lys26 acyl modification rather than by the backbone sequence, and removal of the fatty-acid chain would collapse selectivity toward the undifferentiated amylin/calcitonin receptor profile of native amylin.
Why it’s plausible
The readme notes Eloralintide was engineered to spare the calcitonin receptor relative to amylin receptors. AMY receptors are CTR complexed with RAMP1/2/3, and selectivity between AMY and CTR is typically driven by contacts at the extracellular domains contributed by RAMPs. The Lys26 acyl modification is positioned near the center of the 38-aa sequence and could sterically or electrostatically favor RAMP-containing complexes over bare CTR. The boltz-2 ipTM of 0.87 for a complex with CALCR supports confident receptor docking, but does not specify which CTR complex form (bare vs. RAMP-associated) is modeled.
Why it matters
If selectivity is modification-dependent rather than sequence-intrinsic, the deacylated degradation products of Eloralintide would be non-selective amylin/calcitonin agonists, potentially contributing to unexpected bone-metabolism or renal effects via calcitonin receptor activation in non-target tissues.
Plausibility.50
Novelty.60
Impact.60
Basis · grounding3 computed/notes
[1]
structureboltz-2 complex ipTM=0.87 with CALCR; high confidence for binding, consistent with the amylin/calcitonin receptor family; does not distinguish bare CTR from RAMP-associated AMY receptors.
[2]
noteEloralintide engineered for selectivity toward amylin receptors over calcitonin receptor; Lys26 carries C20 fatty diacid via gamma-Glu-gamma-Glu spacer for albumin binding.
[3]
sequenceKCNTATCATQRLANFLVHSSNNFGPILSSTNVGSNTYQ: Lys26 (K at position 1 in single-letter code corresponds to the acylation site based on readme; the sequence is Lys-numbered from within the amylin backbone) is the modification anchor at a position that could interface with RAMP extracellular loops.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.8668734431266785 boltz-2
ranking score 0.8344197273254395 boltz-2
▸3-letter notation
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Ser-Ser-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-Gln
▸recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights—
hardwarevast_v100_32gb
mlx version—
python—
random seed1
msa strategycolabfold_local
runtime—
predicted by—
predicted at2026-05-22
▸citationbibtex
peptidemodel (2026). Eloralintide (ZP4207): once-weekly weight-loss injection for obesity (pep-10924, v1). PeptideModel. https://peptidemodel.com/card/pep-10924
@peptide{pep10924,
  sequence = {KCNTATCATQRLANFLVHSSNNFGPILSSTNVGSNTYQ},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 5 by signal overlap
clinical trials 10 on ct.gov · checked 2026-05-09
ct.gov trials 10
PubMed RCT 3
by phase
4phase 11phase 25phase 3
by status
2completed8recruiting
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use