Amylin is THE co-agonist partner for GLP-1 in 2026. CagriSema (semaglutide + cagrilintide, PDUFA ~Oct 2026) combines GLP-1R agonism with amylin receptor agonism for superior weight loss.
Petrelintide (Roche, $5.3B deal) and eloralintide are next-gen amylin analogs. GUBamy is a GCGR/amylin dual agonist. The calcitonin receptor with RAMP1/2/3 forms the amylin receptor subtypes AMY1-3.
CALCR is the class B GPCR that mediates calcitonin's inhibition of osteoclast activity and renal calcium excretion - the primary molecular brake on bone resorption. It is also the core component of amylin receptor subtypes (AMY1–3) when complexed with RAMPs 1–3, making it a dual target for bone metabolism and metabolic/satiety research. Salmon calcitonin (sCT) analogs are approved drugs; amylin analog pramlintide targets the CTR/RAMP complexes for glycemic control. Every scaffold aimed at osteoporosis, hypercalcemia, Paget's disease, or post-meal satiety intersects this card.
CALCR (chromosome 7q21.3, 17 exons) encodes a 470–481 aa receptor with a ~120-residue extracellular domain (ECD) containing conserved cysteines that form the ligand-binding pocket. Seven transmembrane helices adopt the canonical class B bundle; activation drives 15 Å outward displacement of TM6 and 9 Å at TM7, opening the Gs docking crevice. N-glycosylation at Asn130 is critical: it stabilizes ECD conformation and improves calcitonin affinity ~10-fold. Salmon calcitonin binds with Kd ~0.5–2 nM (vs. ~50 nM for human calcitonin) due to its C-terminal residue differences. CTR couples primarily to Gs/cAMP/PKA → cytoskeletal retraction and podosome disassembly in osteoclasts → cessation of bone resorption. In some contexts CTR also couples to Gq/PLC/IP3/Ca²⁺. RAMP1/CTR = AMY1 receptor (high amylin affinity); RAMP3/CTR = AMY3; RAMP2/CTR = AMY2 (weak). Desensitization is rapid: GRK2/GRK6 phosphorylate CTR → β-arrestin recruitment → internalization. Splice isoforms differ by an ICL1 insert that influences Gs coupling efficiency.
Salmon calcitonin (intranasal or SC) is approved for postmenopausal osteoporosis, Paget's disease, and hypercalcemia - the only approved peptide hormone that directly agonizes CTR. Major guidelines have deprioritized it for osteoporosis relative to bisphosphonates due to modest efficacy and nasal safety concerns, but it remains clinically used. Pramlintide (synthetic amylin analog) targets AMY1/2/3 and is approved for type 1/2 diabetes as a post-meal glucose lowering agent. sCT(8-32) is the canonical research antagonist - neutral competitive inhibition without inverse agonist activity. For peptide research, the tractable recipes are: sCT analogs with D-amino acid substitutions or PEGylation for improved half-life and selectivity; CGRP/amylin hybrid scaffolds that exploit the AMY1 binding pocket for biased agonism (Gs vs. β-arrestin) to separate anabolic bone effects from osteoclast inhibition; and truncated sCT fragments exploring the partial agonist-to-antagonist transition (positions 5–8 define the boundary) as research probes or therapeutic leads.
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP · 32 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-04432 | Salmon Calcitonin: Miacalcin/Fortical bone-loss & high-calcium drug | pe@peptidemodel | 1 | — | 0 | |
| 2 | pep-10678 | Calcitonin receptor blocker: research tool (Calcitonin (8-32) salmon fragment) | pe@peptidemodel | 6 | — | 0 | |
| 3 | pep-10683 | Migraine-receptor blocker (alpha-CGRP 8-37, rat fragment) | pe@peptidemodel | 8 | — | 0 | |
| 4 | pep-10644 | Beta-CGRP: rat nerve signaling peptide (beta-calcitonin gene-related peptide) | pe@peptidemodel | 8 | — | 0 | |
| 5 | pep-10645 | Alpha-CGRP: natural migraine and pain-signalling peptide | pe@peptidemodel | 7 | — | 0 | |
| 6 | pep-10625 | CGRP tail fragment: lab research tool (NVGSEAF) | pe@peptidemodel | 7 | — | 0 | |
| 7 | pep-10624 | NERP-1: nerve and hormone tissue peptide fragment | pe@peptidemodel | 7 | — | 0 | |
| 8 | pep-10680 | CGRP receptor-binding tail peptide | pe@peptidemodel | 6 | — | 0 | |
| 9 | pep-10677 | Calcitonin-related peptide fragment (alpha-CGRP 23-37) | pe@peptidemodel | 6 | — | 0 | |
| 10 | pep-10646 | CGRP-II: nerve signaling peptide in the calcitonin family (β-CGRP) | pe@peptidemodel | 6 | — | 0 | |
| 11 | pep-10618 | CGRP fragment used in weight-loss drug research (alpha-CGRP 97-119) | pe@peptidemodel | 6 | — | 0 | |
| 12 | pep-10499 | Amylin fragment (8-37): lab research tool | pe@peptidemodel | 6 | — | 0 | |
| 13 | pep-10654 | CGRP receptor blocker fragment (alpha-CGRP 19-37) | pe@peptidemodel | 5 | — | 0 | |
| 14 | pep-10552 | Calcitonin receptor-targeting peptide fragment (CGRP-I precursor 96-119) | pe@peptidemodel | 5 | — | 0 | |
| 15 | pep-10511 | Bone-and-calcium research peptide (CT1, salmon calcitonin fragment) | pe@peptidemodel | 5 | — | 0 | |
| 16 | pep-10488 | β-CGRP: natural nerve-signaling peptide of the calcitonin family | pe@peptidemodel | 5 | — | 0 | |
| 17 | pep-10643 | Biotin-tagged CGRP nerve-signal tracer (canine/mouse/rat) | pe@peptidemodel | 4 | — | 0 | |
| 18 | pep-10608 | Amylin: hunger-suppressing pancreas hormone (hamster research form) | pe@peptidemodel | 4 | — | 0 | |
| 19 | pep-10500 | Amylin-blocker research tool (mouse/rat Amylin 8-37) | pe@peptidemodel | 4 | — | 0 | |
| 20 | pep-10660 | Appetite-regulating hormone fragment from the amylin precursor (IAPP [56-74]) | pe@peptidemodel | 2 | — | 0 |
No discussion threads yet.