secretin receptor family (class B GPCR) · human

CALCR/RAMP

calcitonin receptor
calcitonin receptor / receptor activity-modifying proteins (amylin receptors) · UniProt P30988 · gene CALCR
pain cardiovascular

Amylin is THE co-agonist partner for GLP-1 in 2026. CagriSema (semaglutide + cagrilintide, PDUFA ~Oct 2026) combines GLP-1R agonism with amylin receptor agonism for superior weight loss.

Petrelintide (Roche, $5.3B deal) and eloralintide are next-gen amylin analogs. GUBamy is a GCGR/amylin dual agonist. The calcitonin receptor with RAMP1/2/3 forms the amylin receptor subtypes AMY1-3.

browse 31 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Salmon Calcitonin: Miacalcin/Fortical bone-loss & high-calcium drug

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP · 32 aa · @peptidemodel

bioassayed pep-04432 @peptidemodel refs: 1

all cards · 31 candidates against CALCR/RAMP

# id title author status refs ipSAE_d0chn ♥
2 pep-10678 Calcitonin receptor blocker: research tool (Calcitonin (8-32) salmon fragment) pe@peptidemodel
6 — 0
3 pep-10683 Migraine-receptor blocker (alpha-CGRP 8-37, rat fragment) pe@peptidemodel
8 — 0
4 pep-10644 Beta-CGRP: rat nerve signaling peptide (beta-calcitonin gene-related peptide) pe@peptidemodel
8 — 0
5 pep-10645 Alpha-CGRP: natural migraine and pain-signalling peptide pe@peptidemodel
7 — 0
6 pep-10625 CGRP tail fragment: lab research tool (NVGSEAF) pe@peptidemodel
7 — 0
7 pep-10624 NERP-1: nerve and hormone tissue peptide fragment pe@peptidemodel
7 — 0
8 pep-10680 CGRP receptor-binding tail peptide pe@peptidemodel
6 — 0
9 pep-10677 Calcitonin-related peptide fragment (alpha-CGRP 23-37) pe@peptidemodel
6 — 0
10 pep-10646 CGRP-II: nerve signaling peptide in the calcitonin family (β-CGRP) pe@peptidemodel
6 — 0
11 pep-10618 CGRP fragment used in weight-loss drug research (alpha-CGRP 97-119) pe@peptidemodel
6 — 0
12 pep-10499 Amylin fragment (8-37): lab research tool pe@peptidemodel
6 — 0
13 pep-10654 CGRP receptor blocker fragment (alpha-CGRP 19-37) pe@peptidemodel
5 — 0
14 pep-10552 Calcitonin receptor-targeting peptide fragment (CGRP-I precursor 96-119) pe@peptidemodel
5 — 0
15 pep-10511 Bone-and-calcium research peptide (CT1, salmon calcitonin fragment) pe@peptidemodel
5 — 0
16 pep-10488 β-CGRP: natural nerve-signaling peptide of the calcitonin family pe@peptidemodel
5 — 0
17 pep-10643 Biotin-tagged CGRP nerve-signal tracer (canine/mouse/rat) pe@peptidemodel
4 — 0
18 pep-10608 Amylin: hunger-suppressing pancreas hormone (hamster research form) pe@peptidemodel
4 — 0
19 pep-10500 Amylin-blocker research tool (mouse/rat Amylin 8-37) pe@peptidemodel
4 — 0
20 pep-10660 Appetite-regulating hormone fragment from the amylin precursor (IAPP [56-74]) pe@peptidemodel
2 — 0
1–20 of 31

target literature · 33 curated papers

[2]
Jacobsen, J. et al. 2025 Nature Metabolism CagriSema drives weight loss in rats by reducing energy intake and preserving energy expenditure
cited by
2
cards
[3]
Madsbad, S. et al. 2025 Expert Opinion on Investigational Drugs The promise of glucagon-like peptide 1 receptor agonists (GLP-1RA) for the treatment of obesity: a l
cited by
3
cards
[4]
Hay, D. et al. 2018 British Journal of Pharmacology Update on the pharmacology of calcitonin/CGRP family of peptides: IUPHAR Review 25
cited by
18
cards
[5]
Lee, S. et al. 2016 Journal of Biological Chemistry Calcitonin and Amylin Receptor Peptide Interaction Mechanisms
cited by
17
cards
[6]
Pondel, M. 2000 International Journal of Experimental Pathology Calcitonin and calcitonin receptors: bone and beyond
cited by
9
cards
[7]
Lin, H. et al. 1991 Science Expression Cloning of an Adenylate Cyclase-Coupled Calcitonin Receptor
cited by
1
cards
[8]
Barwell, J. et al. 2012 British Journal of Pharmacology Calcitonin and calcitonin receptor‐like receptors: common themes with family B GPCRs?
cited by
16
cards
recent news 5 articles

discussion · 0 threads

No discussion threads yet.