The bone-building receptor - PTH and PTHrP binding here is the only pharmacologically proven way to stimulate new bone formation rather than just prevent bone loss. Approved anabolic drugs teriparatide (PTH 1-34) and abaloparatide (PTHrP-based) are first-line treatments for severe osteoporosis. Also governs calcium/phosphate homeostasis systemically. Used for: osteoporosis, hypoparathyroidism, bone repair.
PTH1R is the class B GPCR that mediates both PTH's systemic calcium/phosphate homeostasis actions and PTHrP's local paracrine control of bone formation, cartilage development, and epithelial differentiation - making it simultaneously the regulator of the calcium set-point and the anabolic driver of osteoblast activity. Teriparatide (PTH 1-34) and abaloparatide (PTHrP-based) are FDA-approved anabolic osteoporosis drugs. PTH1R also generates sustained endosomal cAMP signaling - a unique class B GPCR property with major implications for pharmacological design. Every scaffold for osteoporosis, hypoparathyroidism, or bone-forming peptide research forks from this card.
PTH1R (chromosome 3p21.31, 593 aa) adopts canonical class B GPCR architecture: a 165-aa N-terminal ECD that captures the C-terminal helix of PTH/PTHrP, a seven-TM bundle that is activated by the peptide N-terminus, and a ~100-aa C-terminal tail with GRK phosphorylation sites for β-arrestin. Two-domain binding: PTH(15-34) C-terminal helix docks into the ECD hydrophobic groove (Ile38, Leu41 contacts Trp23, Leu24 of PTH; Asp137 salt-bridges PTH Arg20); this positions PTH(1-14) N-terminus to engage TM5/TM6 (Val2, Ile5 against Phe288, Leu292), driving receptor activation. The ECD is stabilized by three disulfide bonds (Cys48–Cys117, Cys108–Cys148, Cys131–Cys170). Signaling: Gαs → adenylyl cyclase → cAMP → PKA → CREB → bone anabolic genes and renal tubular phosphate excretion/calcium reabsorption (primary); Gαq/11 → PLC → Ca²⁺/PKC; Gα12/13; β-arrestin → ERK and endosomal cAMP prolongation. Sustained endosomal PTH1R-cAMP signaling after internalization is distinct from plasma membrane signaling and is prolonged by β-arrestin scaffolding - this endosomal component drives the anabolic bone effect uniquely associated with once-daily intermittent PTH dosing. Activating PTH1R mutations (H223R, T410P) cause Jansen metaphyseal chondrodysplasia; inactivating mutations cause Blomstrand lethal chondrodysplasia.
Approved: teriparatide (recombinant PTH 1-34, SC daily) for severe osteoporosis - increases bone mineral density and reduces fractures by anabolic osteoblast activation; approved in US and EU. Abaloparatide (PTHrP-based analog with an Aib²,Leu¹¹,D-Ala¹²,Aib¹⁷ sequence for enhanced G protein bias) is FDA-approved for osteoporosis, showing anabolic potency with less hypercalcemia than teriparatide. Both are approved for ≤24 months lifetime use due to theoretical osteosarcoma risk from prolonged continuous receptor activation. Cinacalcet (allosteric CaSR modulator, not PTH1R direct) reduces PTH secretion in secondary hyperparathyroidism. SEP-786 (oral small molecule PTH1R agonist) is in Phase 2 for hypoparathyroidism. For peptide research, the tractable recipes are: PTH(1-34) Aib-scanning at positions 3, 7, 10 for DPP-4/protease resistance while preserving the G protein bias toward Gs over β-arrestin; PTHrP(1-36) truncations to identify the minimum N-terminal sequence for full anabolic signaling; Gs-biased PTH analogs that maximize endosomal cAMP duration (Ala¹-modified scaffolds) for once-weekly osteoporosis dosing; and LA-PTH (long-acting PTH analogs with high-affinity ECD binding through C-terminal extensions for sustained receptor occupancy) as templates for hypoparathyroidism replacement therapy.
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF · 34 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10663 | Teriparatide: Forteo/Bonsity bone-building drug for osteoporosis | pe@peptidemodel | 6 | — | 0 | |
| 2 | pep-10661 | Bone-signaling peptide fragment: parathyroid hormone (1, 13) | pe@peptidemodel | 10 | — | 0 | |
| 3 | pep-10503 | Bone-building peptide from a cancer-linked protein (PTHrP 1-36) | pe@peptidemodel | 10 | — | 0 | |
| 4 | pep-10975 | Abaloparatide: Tymlos bone-building osteoporosis drug | pe@peptidemodel | 5 | — | 0 | |
| 5 | pep-10508 | Rat parathyroid hormone fragment: lab version of Forteo (PTH 1-34) | pe@peptidemodel | 9 | — | 0 | |
| 6 | pep-10506 | Bone-signaling research tool (Tyr36-PTHrP 1-36) | pe@peptidemodel | 6 | — | 0 | |
| 7 | pep-10505 | Bone-and-calcium-signaling peptide (PTHrP 1-40) | pe@peptidemodel | 6 | — | 0 | |
| 8 | pep-10502 | Bone-building cancer-calcium peptide: PTHrP (1-34) fragment | pe@peptidemodel | 6 | — | 0 | |
| 9 | pep-10501 | Bone-receptor research fragment (PTHrP 1-16) | pe@peptidemodel | 5 | — | 0 | |
| 10 | pep-10781 | Parathyroid hormone fragment that blocks its own receptor (PTH 13: 34) | pe@peptidemodel | 7 | — | 0 | |
| 11 | pep-10444 | Bone-and-calcium-regulating peptide (CHEMBL526530) | pe@peptidemodel | 3 | — | 0 | |
| 12 | pep-10440 | Bone-signaling peptide (CHEMBL450474) | pe@peptidemodel | 3 | — | 0 | |
| 13 | pep-10617 | PTHrP(7-34) blocker: research tool for bone and calcium studies (Hypercalcemia Malignancy Factor fragment) | pe@peptidemodel | 6 | — | 0 | |
| 14 | pep-10507 | Bone-building parathyroid hormone fragment: bovine version (PTH 1-34) | pe@peptidemodel | 6 | — | 0 | |
| 15 | pep-10443 | Bone-signaling peptide (CHEMBL514849) | pe@peptidemodel | 2 | — | 0 | |
| 16 | pep-10442 | Bone-and-calcium-regulating peptide (CHEMBL506126) | pe@peptidemodel | 2 | — | 0 | |
| 17 | pep-10441 | Bone-and-calcium-signaling peptide (CHEMBL499651) | pe@peptidemodel | 2 | — | 0 | |
| 18 | pep-10439 | Bone-signaling peptide (CHEMBL1276263) | pe@peptidemodel | 2 | — | 0 | |
| 19 | pep-10438 | Bone-and-calcium-regulating peptide (CHEMBL1276262) | pe@peptidemodel | 2 | — | 0 | |
| 20 | pep-10504 | Bone & calcium signaling peptide (PTHrP 1-37) | pe@peptidemodel | 5 | — | 0 |
No discussion threads yet.