secretin-like GPCR (class B) · human

PTH1R

PTH receptor type 1
parathyroid hormone 1 receptor · UniProt Q03431 · gene PTH1R
cardiovascular aging

The bone-building receptor - PTH and PTHrP binding here is the only pharmacologically proven way to stimulate new bone formation rather than just prevent bone loss. Approved anabolic drugs teriparatide (PTH 1-34) and abaloparatide (PTHrP-based) are first-line treatments for severe osteoporosis. Also governs calcium/phosphate homeostasis systemically. Used for: osteoporosis, hypoparathyroidism, bone repair.

browse 25 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Teriparatide: Forteo/Bonsity bone-building drug for osteoporosis

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF · 34 aa · @peptidemodel

synthesized pep-10663 @peptidemodel refs: 6

all cards · 25 candidates against PTH1R

# id title author status refs ipSAE_d0chn
1 pep-10663 Teriparatide: Forteo/Bonsity bone-building drug for osteoporosis pe@peptidemodel
6 0
2 pep-10661 Bone-signaling peptide fragment: parathyroid hormone (1, 13) pe@peptidemodel
10 0
3 pep-10503 Bone-building peptide from a cancer-linked protein (PTHrP 1-36) pe@peptidemodel
10 0
4 pep-10975 Abaloparatide: Tymlos bone-building osteoporosis drug pe@peptidemodel
5 0
5 pep-10508 Rat parathyroid hormone fragment: lab version of Forteo (PTH 1-34) pe@peptidemodel
9 0
6 pep-10506 Bone-signaling research tool (Tyr36-PTHrP 1-36) pe@peptidemodel
6 0
7 pep-10505 Bone-and-calcium-signaling peptide (PTHrP 1-40) pe@peptidemodel
6 0
8 pep-10502 Bone-building cancer-calcium peptide: PTHrP (1-34) fragment pe@peptidemodel
6 0
9 pep-10501 Bone-receptor research fragment (PTHrP 1-16) pe@peptidemodel
5 0
10 pep-10781 Parathyroid hormone fragment that blocks its own receptor (PTH 13: 34) pe@peptidemodel
7 0
11 pep-10444 Bone-and-calcium-regulating peptide (CHEMBL526530) pe@peptidemodel
3 0
12 pep-10440 Bone-signaling peptide (CHEMBL450474) pe@peptidemodel
3 0
13 pep-10617 PTHrP(7-34) blocker: research tool for bone and calcium studies (Hypercalcemia Malignancy Factor fragment) pe@peptidemodel
6 0
14 pep-10507 Bone-building parathyroid hormone fragment: bovine version (PTH 1-34) pe@peptidemodel
6 0
15 pep-10443 Bone-signaling peptide (CHEMBL514849) pe@peptidemodel
2 0
16 pep-10442 Bone-and-calcium-regulating peptide (CHEMBL506126) pe@peptidemodel
2 0
17 pep-10441 Bone-and-calcium-signaling peptide (CHEMBL499651) pe@peptidemodel
2 0
18 pep-10439 Bone-signaling peptide (CHEMBL1276263) pe@peptidemodel
2 0
19 pep-10438 Bone-and-calcium-regulating peptide (CHEMBL1276262) pe@peptidemodel
2 0
20 pep-10504 Bone & calcium signaling peptide (PTHrP 1-37) pe@peptidemodel
5 0
1–20 of 25

target literature · 31 curated papers

[4]
Leder, Benjamin Z. 2017 Current Osteoporosis Reports Parathyroid Hormone and Parathyroid Hormone-Related Protein Analogs in Osteoporosis Therapy
cited by
3
cards
[5]
Höppner, Jakob et al. 2025 Nature Communications Prolonging parathyroid hormone analog action in vitro and in vivo through peptide lipidation
cited by
1
cards
[6]
Hattersley GDean TCorbin BABahar HGardella TJ 2016 Endocrinology Binding Selectivity of Abaloparatide for PTH-Type-1-Receptor Conformations and Effects on Downstream Signaling
cited by
13
cards
[9]
Lee, M. et al. 2009 Current Opinion in Nephrology and Hypertension Parathyroid hormone signaling in bone and kidney
cited by
6
cards
[10]
Sutkeviciute, I. et al. 2019 Trends in Endocrinology & Metabolism PTH/PTHrP Receptor Signaling, Allostery, and Structures
cited by
6
cards
recent news 2 articles

discussion · 0 threads

No discussion threads yet.