Survodutide: dual weight-loss & liver-disease drug (BI 456906)
Experimental once-weekly injection that activates two hormone pathways to reduce weight and treat a serious liver disease called MASH; in late-stage clinical trials, not yet an approved drug.
- Class
- Dual GLP-1 receptor / glucagon receptor agonist (unimolecular, synthetic)
- Status
- Investigational — not approved by FDA, EMA, or any major regulatory authority; Phase 3 development underway
- Best-supported effect
- Weight loss (~14.9% mean body weight at 46 weeks; up to 18.7% in completers at 4.8 mg) and MASH histologic resolution (62% at 48 weeks) in Phase 2 RCTs; Phase 3 confirmatory results pending
- Main caveat
- All efficacy and safety data are from Phase 2 only; Phase 3 SYNCHRONIZE confirmatory results not yet available; no head-to-head data versus approved incretin agents; approximately 25% Phase 2 discontinuation rate at highest dose
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Survodutide (also known by its development code BI 456906) is an investigational synthetic peptide co-developed by Zealand Pharma and Boehringer Ingelheim. It is designed to activate two hormone receptors at once — the GLP-1 receptor and the glucagon receptor (GCGR) — using a single molecule derived from oxyntomodulin, a naturally occurring hormone produced from the same gene as glucagon and GLP-1. This dual-receptor approach sets it apart from pure GLP-1 agonists such as semaglutide, and from the GIP/GLP-1 dual agonist tirzepatide. Survodutide is under investigation for obesity, type 2 diabetes, and a liver disease called MASH (metabolic dysfunction-associated steatohepatitis). It is not approved by the FDA, EMA, or any regulatory authority; as of current sources, Phase 3 trials (the SYNCHRONIZE program) are actively running, with results expected in 2026–2027. The stored sequence HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRX represents the peptide backbone; the terminal X encodes a structural modification that contributes to the compound's extended weekly duration of action, and is not visible as a standard amino acid in the raw sequence.
History
Survodutide originated as a Zealand Pharma program built on the oxyntomodulin backbone. Oxyntomodulin is a natural post-translational product of the proglucagon gene that intrinsically activates both the GLP-1 and glucagon receptors — making it a starting point for dual-agonist design. Zealand partnered the molecule with Boehringer Ingelheim in 2011; Boehringer took operational control of clinical development while Zealand retained royalty rights. Early Phase 1 and Phase 2 work through the late 2010s and early 2020s established dose-dependent weight loss and a distinctive liver-targeted efficacy signal. The compound's profile rose substantially with two major Phase 2 readouts published in 2024: le Roux and colleagues (Lancet Diabetes & Endocrinology, 2024) reported results from a dose-finding obesity trial, and Sanyal and colleagues (New England Journal of Medicine, 2024) reported results in MASH and fibrosis — both positioning survodutide as a serious late-stage contender in the incretin class.
What it does
Survodutide works through two complementary mechanisms acting simultaneously. The GLP-1 receptor component reduces appetite and slows digestion, cutting caloric intake — the same pathway activated by semaglutide and tirzepatide. The glucagon receptor component does something different: it signals the liver to burn more fat and increases overall energy expenditure. This two-pronged action — less energy in via GLP-1R, more energy out via GCGR — is the biological rationale for its development. The GCGR-mediated liver effects are also directly relevant to MASH, where survodutide's Phase 2 histologic results substantially exceeded placebo. The trade-off is that adding glucagon receptor activity appears to amplify early gastrointestinal side effects relative to pure GLP-1 agonists.
Evidence
- Human: Phase 2 results are the strongest data available. In the obesity trial (n=387, 46 weeks), le Roux and colleagues (Lancet Diabetes & Endocrinology, 2024) reported 14.9% mean body weight reduction at the highest dose versus −2.8% on placebo; completers at that dose reached 18.7% loss. In MASH, Sanyal and colleagues (New England Journal of Medicine, 2024) reported MASH histologic resolution in 62% of participants at the highest dose versus 14% on placebo, with 36% showing fibrosis stage improvement, over 48 weeks in adults with F1–F3 fibrosis. Phase 3 data (SYNCHRONIZE-1 for obesity without T2D, SYNCHRONIZE-2 for obesity with T2D, SYNCHRONIZE-CVOT for cardiovascular outcomes) are not yet available; no head-to-head data versus tirzepatide or semaglutide has been reported.
- Animal: The dual GCGR/GLP-1R agonism concept is supported in preclinical models demonstrating additive effects on weight loss, energy expenditure, and hepatic fat reduction relative to mono-agonist comparators.
- In vitro: Published pharmacological profiling characterizes survodutide as a potent GLP-1R agonist with additional meaningful GCGR activity; the relative receptor potency profile (greater at GLP-1R than GCGR) has been reported in pharmacological characterization published separately from the Phase 2 clinical papers.
Myths and misconceptions
- "Survodutide is available if you know where to look." — Survodutide is an investigational compound in active Phase 3 development. Legitimate access is limited to enrollment in the SYNCHRONIZE program or other registered clinical trials. Research-chemical suppliers advertising "survodutide" outside trial oversight are not selling a pharmaceutical product; identity, purity, and potency cannot be assumed.
- "Adding glucagon to GLP-1 is obviously better than GLP-1 alone." — The dual-agonist rationale is mechanistically sound and Phase 2 numbers are strong, but no head-to-head comparison against semaglutide 2.4 mg or tirzepatide has been published. Cross-trial numeric comparisons between Phase 2 survodutide and Phase 3 data from approved agents are methodologically unreliable. The glucagon component also raises the GI-tolerability bar: roughly 25% of participants discontinued in the highest Phase 2 dose arm (le Roux et al., 2024), a rate the published literature characterizes as higher than comparable pure GLP-1 programs.
- "The MASH results mean survodutide cures fatty liver." — The Phase 2 MASH trial (Sanyal et al., 2024) showed MASH resolution in 62% of participants and fibrosis improvement in 36% at 48 weeks — a striking histologic signal, but not a cure. MASH is a progressive disease; whether gains persist long-term, reduce cirrhosis risk, or hold after stopping treatment has not been established. Survodutide remains investigational, and no drug currently cures MASH.
Known effects
- Weight loss in adults with obesity — Phase 2 RCT (Emerging; Phase 3 confirmatory results pending)
- MASH histologic resolution — Phase 2 RCT (Emerging; single trial; Phase 3 MASH-specific results pending)
- Liver fibrosis stage improvement — Phase 2 RCT (Emerging; 48-week endpoint; long-term durability not established)
- Increased energy expenditure via GCGR — Mechanistic / preclinical (not directly measured as an isolated endpoint in available human clinical publications)
Safety signals
Gastrointestinal adverse events — nausea, vomiting, diarrhea, decreased appetite, constipation — are the dominant tolerability concern and consistent with dual GLP-1R/GCGR pharmacology. In the Phase 2 obesity trial, approximately 25% of participants discontinued due to adverse events in the highest-dose arm (le Roux et al., 2024); the published literature characterizes this as higher than comparable pure GLP-1 agonist programs, attributed partly to glucagon-receptor activation amplifying early GI symptoms. Phase 3 uses refined titration schedules; whether real-world GI tolerability improves to levels seen with pure GLP-1 agents is unresolved.
A post-hoc analysis from the Phase 2 obesity trial described blood pressure changes in adults with obesity; direction and clinical significance are being characterized in Phase 3 and SYNCHRONIZE-CVOT. Potential heart-rate effects from chronic GCGR agonism are flagged as an area distinct from pure GLP-1 agents, requiring Phase 3 characterization.
Glucagon receptor activation raises hepatic glucose output. In dual agonism this is ordinarily offset by GLP-1R insulinotropic activity, but the net glycemic balance in specific populations — lean individuals, older patients, T2D patients on complex antidiabetic regimens — is being evaluated in SYNCHRONIZE-2.
The SYNCHRONIZE trials apply exclusion criteria by analogy to the GLP-1 class: personal or family history of medullary thyroid carcinoma, MEN2, advanced cirrhosis (Child-Pugh C), severe pancreatitis history, and severe gastroparesis. These are trial exclusion criteria from an investigational program, not an approved drug label.
Long-term effects of sustained GCGR agonism on hepatic glucose homeostasis, cardiac muscle, and blood pressure over years have not been characterized; Phase 3 and subsequent pharmacovigilance will be required.
Regulatory status
- US (FDA): Not approved. Access is limited to SYNCHRONIZE Phase 3 enrollment or other registered trials; not available through compounding pharmacies; not legally marketed.
- EU / international: Not approved by any regulatory authority. Clinical trial sites are active across the EU, UK, North America, and parts of Asia; access remains investigational worldwide.
- WADA: Prohibited under S0 — survodutide is not individually named on the WADA Prohibited List but falls under the S0 category ("substances not currently approved by any governmental regulatory health authority for human therapeutic use"), which applies to survodutide as an investigational compound.
Mechanism
Survodutide is a synthetic, long-acting peptide derived from oxyntomodulin — an endogenous proglucagon gene product that naturally activates both the GLP-1 receptor (GLP-1R) and the glucagon receptor (GCGR). It is engineered for prolonged activity consistent with once-weekly subcutaneous dosing. Published pharmacological profiling characterizes it as having greater relative potency at GLP-1R than at GCGR, with meaningful activity at both.
GLP-1R activation in the hypothalamus and brainstem suppresses appetite and reduces caloric intake; delayed gastric emptying also contributes. GCGR activation in the liver promotes fatty acid oxidation, raises whole-body energy expenditure, and stimulates thermogenesis — mechanisms distinct from those of pure GLP-1 agonists. The complementary and non-overlapping nature of these two pathways is the mechanistic rationale for expecting additive metabolic effects. The GCGR-mediated hepatic effects are proposed as the primary driver of survodutide's MASH histologic improvement signal in Phase 2 (Sanyal et al., 2024).
Glucagon receptor activation also raises hepatic glucose output. In dual agonism, this is typically offset by GLP-1R-driven insulin secretion, but the net glycemic profile in patients with insulin-dependent or complex antidiabetic regimens — populations less well-studied in Phase 2 — is being characterized in SYNCHRONIZE-2.
Both receptor pathways are individually well-characterized from decades of prior research. The principal unknowns concern how dual-target pharmacology at full Phase 3 scale performs on efficacy, tolerability, and safety endpoints, particularly cardiovascular outcomes (SYNCHRONIZE-CVOT) and long-term MASH durability.
Open questions
- Phase 3 efficacy confirmation: SYNCHRONIZE-1 and SYNCHRONIZE-2 are the definitive weight-loss efficacy tests. Whether Phase 2 results (le Roux et al., 2024) replicate at Phase 3 scale is the central open question; approval and market positioning depend on these readouts.
- Head-to-head comparisons: No direct randomized comparison versus tirzepatide, semaglutide 2.4 mg, or cagrilintide/semaglutide combination has been conducted. Cross-trial comparisons cannot substitute for a head-to-head RCT.
- Cardiovascular outcomes: SYNCHRONIZE-CVOT is designed to establish MACE reduction. Until it reports, cardiovascular benefit is inferred from class-level signals, not directly demonstrated for survodutide.
- Long-term MASH and fibrosis outcomes: Sanyal and colleagues (2024) demonstrated histologic improvement at 48 weeks. Effects on fibrosis progression, cirrhosis risk, hepatic decompensation, and histologic outcomes after stopping treatment have not been reported.
- GI tolerability at Phase 3 scale: The approximately 25% adverse-event discontinuation rate at the highest Phase 2 dose (le Roux et al., 2024) is a clinically relevant signal. Phase 3 uses refined titration schedules; whether real-world tolerability improves to levels seen with pure GLP-1 agonists is unresolved.
- Long-term effects of chronic GCGR agonism: Sustained glucagon-receptor activation over years — effects on hepatic glucose output, cardiac physiology, and blood pressure — has not been characterized. This is a pharmacological concern that pure GLP-1 programs do not share, and will require Phase 3 data and post-approval pharmacovigilance to address.
- Optimal patient selection: Whether the dual GCGR/GLP-1R mechanism confers specific advantage in patients with high liver fat, high baseline BMI, or metabolic syndrome relative to GLP-1-only agents has not been established from comparative or biomarker-stratified data.
Related peptides
Survodutide's closest relatives in mechanism and development stage include oxyntomodulin (its natural parent hormone), retatrutide (a triple GIP/GLP-1R/GCGR agonist), and the approved GLP-1 agonists it is often compared against in the obesity and MASH space. See also semaglutide — the leading approved GLP-1 agonist for obesity and T2D — and tirzepatide — the GIP/GLP-1R dual agonist approved for T2D and obesity.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Does survodutide improve fatty liver disease by directly activating liver cells to burn fat, even in patients who have not lost much weight?
If survodutide can treat fatty liver independently of weight loss, it could help the many MASH patients who are not obese or who cannot tolerate the appetite-suppressing side effects of GLP-1 drugs, addressing a disease with no approved treatments.
Since alcohol and metabolic syndrome damage the liver through similar processes, could survodutide treat liver disease caused by alcohol as well as by obesity?
Alcohol-related liver disease has no approved drugs and causes thousands of deaths annually; if survodutide can be repurposed for this condition once validated in MASH, it could reach patients desperately in need of treatment options much faster than starting a new drug from scratch.
Is the main side effect limiting how much survodutide patients can take related to the heart rather than the stomach nausea typical of GLP-1 drugs?
Knowing which side effect sets the maximum dose tells drug developers exactly what to engineer around in the next generation, potentially leading to a safer version that can be dosed high enough to fully treat liver disease without cardiovascular risk.
Is the reason survodutide acts more on the glucagon receptor than the GLP-1 receptor that it has one negatively charged building block where GLP-1 drugs have a neutral one?
If this single-residue rule is confirmed, drug designers could precisely dial up or down the liver-fat-burning versus appetite-suppressing balance in future drugs, creating tailored treatments for people who need more liver benefit or more weight loss.
By activating the liver to process amino acids differently, could survodutide help people lose fat without losing as much muscle as they would on a GLP-1 drug?
Losing muscle along with fat during weight loss reduces long-term metabolic health and physical strength; a drug that preserves muscle while reducing fat would be far more beneficial, especially for older patients and those trying to maintain activity levels.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.7589980959892273 | boltz-2 |
| ranking score | 0.7663209438323975 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | colabfold_local |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep10899,
sequence = {HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRX},
target = {gcgr},
author = {peptidemodel},
year = {2026},
status = {computed}
}