pe
pep-10899 v1 CC-BY-SA-4.0

Survodutide: dual weight-loss & liver-disease drug (BI 456906)

Experimental once-weekly injection that activates two hormone pathways to reduce weight and treat a serious liver disease called MASH; in late-stage clinical trials, not yet an approved drug.

statuscomputed targetGCGR length31 aa refs2
snapshot clinical 0% confidence
Class
Dual GLP-1 receptor / glucagon receptor agonist (unimolecular, synthetic)
Status
Investigational — not approved by FDA, EMA, or any major regulatory authority; Phase 3 development underway
Best-supported effect
Weight loss (~14.9% mean body weight at 46 weeks; up to 18.7% in completers at 4.8 mg) and MASH histologic resolution (62% at 48 weeks) in Phase 2 RCTs; Phase 3 confirmatory results pending
Main caveat
All efficacy and safety data are from Phase 2 only; Phase 3 SYNCHRONIZE confirmatory results not yet available; no head-to-head data versus approved incretin agents; approximately 25% Phase 2 discontinuation rate at highest dose
status 2 / 5
prediction metrics boltz-2 2.2.1
ipTM0.759
pTM0.849
avg pLDDT76.8
ranking score0.766
STRUCTURE · PEP-10899 × GCGR
ranking0.766
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence31 aa
15101520253031
HGEGTFTSDVSSYLEG QAAKEFIAWLVKGRX
in the news 24 articles
overview readme

What this is

Survodutide (also known by its development code BI 456906) is an investigational synthetic peptide co-developed by Zealand Pharma and Boehringer Ingelheim. It is designed to activate two hormone receptors at once — the GLP-1 receptor and the glucagon receptor (GCGR) — using a single molecule derived from oxyntomodulin, a naturally occurring hormone produced from the same gene as glucagon and GLP-1. This dual-receptor approach sets it apart from pure GLP-1 agonists such as semaglutide, and from the GIP/GLP-1 dual agonist tirzepatide. Survodutide is under investigation for obesity, type 2 diabetes, and a liver disease called MASH (metabolic dysfunction-associated steatohepatitis). It is not approved by the FDA, EMA, or any regulatory authority; as of current sources, Phase 3 trials (the SYNCHRONIZE program) are actively running, with results expected in 2026–2027. The stored sequence HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRX represents the peptide backbone; the terminal X encodes a structural modification that contributes to the compound's extended weekly duration of action, and is not visible as a standard amino acid in the raw sequence.


History

Survodutide originated as a Zealand Pharma program built on the oxyntomodulin backbone. Oxyntomodulin is a natural post-translational product of the proglucagon gene that intrinsically activates both the GLP-1 and glucagon receptors — making it a starting point for dual-agonist design. Zealand partnered the molecule with Boehringer Ingelheim in 2011; Boehringer took operational control of clinical development while Zealand retained royalty rights. Early Phase 1 and Phase 2 work through the late 2010s and early 2020s established dose-dependent weight loss and a distinctive liver-targeted efficacy signal. The compound's profile rose substantially with two major Phase 2 readouts published in 2024: le Roux and colleagues (Lancet Diabetes & Endocrinology, 2024) reported results from a dose-finding obesity trial, and Sanyal and colleagues (New England Journal of Medicine, 2024) reported results in MASH and fibrosis — both positioning survodutide as a serious late-stage contender in the incretin class.


What it does

Survodutide works through two complementary mechanisms acting simultaneously. The GLP-1 receptor component reduces appetite and slows digestion, cutting caloric intake — the same pathway activated by semaglutide and tirzepatide. The glucagon receptor component does something different: it signals the liver to burn more fat and increases overall energy expenditure. This two-pronged action — less energy in via GLP-1R, more energy out via GCGR — is the biological rationale for its development. The GCGR-mediated liver effects are also directly relevant to MASH, where survodutide's Phase 2 histologic results substantially exceeded placebo. The trade-off is that adding glucagon receptor activity appears to amplify early gastrointestinal side effects relative to pure GLP-1 agonists.


Evidence

  • Human: Phase 2 results are the strongest data available. In the obesity trial (n=387, 46 weeks), le Roux and colleagues (Lancet Diabetes & Endocrinology, 2024) reported 14.9% mean body weight reduction at the highest dose versus −2.8% on placebo; completers at that dose reached 18.7% loss. In MASH, Sanyal and colleagues (New England Journal of Medicine, 2024) reported MASH histologic resolution in 62% of participants at the highest dose versus 14% on placebo, with 36% showing fibrosis stage improvement, over 48 weeks in adults with F1–F3 fibrosis. Phase 3 data (SYNCHRONIZE-1 for obesity without T2D, SYNCHRONIZE-2 for obesity with T2D, SYNCHRONIZE-CVOT for cardiovascular outcomes) are not yet available; no head-to-head data versus tirzepatide or semaglutide has been reported.
  • Animal: The dual GCGR/GLP-1R agonism concept is supported in preclinical models demonstrating additive effects on weight loss, energy expenditure, and hepatic fat reduction relative to mono-agonist comparators.
  • In vitro: Published pharmacological profiling characterizes survodutide as a potent GLP-1R agonist with additional meaningful GCGR activity; the relative receptor potency profile (greater at GLP-1R than GCGR) has been reported in pharmacological characterization published separately from the Phase 2 clinical papers.

Myths and misconceptions

  • "Survodutide is available if you know where to look." — Survodutide is an investigational compound in active Phase 3 development. Legitimate access is limited to enrollment in the SYNCHRONIZE program or other registered clinical trials. Research-chemical suppliers advertising "survodutide" outside trial oversight are not selling a pharmaceutical product; identity, purity, and potency cannot be assumed.
  • "Adding glucagon to GLP-1 is obviously better than GLP-1 alone." — The dual-agonist rationale is mechanistically sound and Phase 2 numbers are strong, but no head-to-head comparison against semaglutide 2.4 mg or tirzepatide has been published. Cross-trial numeric comparisons between Phase 2 survodutide and Phase 3 data from approved agents are methodologically unreliable. The glucagon component also raises the GI-tolerability bar: roughly 25% of participants discontinued in the highest Phase 2 dose arm (le Roux et al., 2024), a rate the published literature characterizes as higher than comparable pure GLP-1 programs.
  • "The MASH results mean survodutide cures fatty liver." — The Phase 2 MASH trial (Sanyal et al., 2024) showed MASH resolution in 62% of participants and fibrosis improvement in 36% at 48 weeks — a striking histologic signal, but not a cure. MASH is a progressive disease; whether gains persist long-term, reduce cirrhosis risk, or hold after stopping treatment has not been established. Survodutide remains investigational, and no drug currently cures MASH.

Known effects

  • Weight loss in adults with obesity — Phase 2 RCT (Emerging; Phase 3 confirmatory results pending)
  • MASH histologic resolution — Phase 2 RCT (Emerging; single trial; Phase 3 MASH-specific results pending)
  • Liver fibrosis stage improvement — Phase 2 RCT (Emerging; 48-week endpoint; long-term durability not established)
  • Increased energy expenditure via GCGR — Mechanistic / preclinical (not directly measured as an isolated endpoint in available human clinical publications)

Safety signals

Gastrointestinal adverse events — nausea, vomiting, diarrhea, decreased appetite, constipation — are the dominant tolerability concern and consistent with dual GLP-1R/GCGR pharmacology. In the Phase 2 obesity trial, approximately 25% of participants discontinued due to adverse events in the highest-dose arm (le Roux et al., 2024); the published literature characterizes this as higher than comparable pure GLP-1 agonist programs, attributed partly to glucagon-receptor activation amplifying early GI symptoms. Phase 3 uses refined titration schedules; whether real-world GI tolerability improves to levels seen with pure GLP-1 agents is unresolved.

A post-hoc analysis from the Phase 2 obesity trial described blood pressure changes in adults with obesity; direction and clinical significance are being characterized in Phase 3 and SYNCHRONIZE-CVOT. Potential heart-rate effects from chronic GCGR agonism are flagged as an area distinct from pure GLP-1 agents, requiring Phase 3 characterization.

Glucagon receptor activation raises hepatic glucose output. In dual agonism this is ordinarily offset by GLP-1R insulinotropic activity, but the net glycemic balance in specific populations — lean individuals, older patients, T2D patients on complex antidiabetic regimens — is being evaluated in SYNCHRONIZE-2.

The SYNCHRONIZE trials apply exclusion criteria by analogy to the GLP-1 class: personal or family history of medullary thyroid carcinoma, MEN2, advanced cirrhosis (Child-Pugh C), severe pancreatitis history, and severe gastroparesis. These are trial exclusion criteria from an investigational program, not an approved drug label.

Long-term effects of sustained GCGR agonism on hepatic glucose homeostasis, cardiac muscle, and blood pressure over years have not been characterized; Phase 3 and subsequent pharmacovigilance will be required.


Regulatory status

  • US (FDA): Not approved. Access is limited to SYNCHRONIZE Phase 3 enrollment or other registered trials; not available through compounding pharmacies; not legally marketed.
  • EU / international: Not approved by any regulatory authority. Clinical trial sites are active across the EU, UK, North America, and parts of Asia; access remains investigational worldwide.
  • WADA: Prohibited under S0 — survodutide is not individually named on the WADA Prohibited List but falls under the S0 category ("substances not currently approved by any governmental regulatory health authority for human therapeutic use"), which applies to survodutide as an investigational compound.

Mechanism

Survodutide is a synthetic, long-acting peptide derived from oxyntomodulin — an endogenous proglucagon gene product that naturally activates both the GLP-1 receptor (GLP-1R) and the glucagon receptor (GCGR). It is engineered for prolonged activity consistent with once-weekly subcutaneous dosing. Published pharmacological profiling characterizes it as having greater relative potency at GLP-1R than at GCGR, with meaningful activity at both.

GLP-1R activation in the hypothalamus and brainstem suppresses appetite and reduces caloric intake; delayed gastric emptying also contributes. GCGR activation in the liver promotes fatty acid oxidation, raises whole-body energy expenditure, and stimulates thermogenesis — mechanisms distinct from those of pure GLP-1 agonists. The complementary and non-overlapping nature of these two pathways is the mechanistic rationale for expecting additive metabolic effects. The GCGR-mediated hepatic effects are proposed as the primary driver of survodutide's MASH histologic improvement signal in Phase 2 (Sanyal et al., 2024).

Glucagon receptor activation also raises hepatic glucose output. In dual agonism, this is typically offset by GLP-1R-driven insulin secretion, but the net glycemic profile in patients with insulin-dependent or complex antidiabetic regimens — populations less well-studied in Phase 2 — is being characterized in SYNCHRONIZE-2.

Both receptor pathways are individually well-characterized from decades of prior research. The principal unknowns concern how dual-target pharmacology at full Phase 3 scale performs on efficacy, tolerability, and safety endpoints, particularly cardiovascular outcomes (SYNCHRONIZE-CVOT) and long-term MASH durability.


Open questions

  • Phase 3 efficacy confirmation: SYNCHRONIZE-1 and SYNCHRONIZE-2 are the definitive weight-loss efficacy tests. Whether Phase 2 results (le Roux et al., 2024) replicate at Phase 3 scale is the central open question; approval and market positioning depend on these readouts.
  • Head-to-head comparisons: No direct randomized comparison versus tirzepatide, semaglutide 2.4 mg, or cagrilintide/semaglutide combination has been conducted. Cross-trial comparisons cannot substitute for a head-to-head RCT.
  • Cardiovascular outcomes: SYNCHRONIZE-CVOT is designed to establish MACE reduction. Until it reports, cardiovascular benefit is inferred from class-level signals, not directly demonstrated for survodutide.
  • Long-term MASH and fibrosis outcomes: Sanyal and colleagues (2024) demonstrated histologic improvement at 48 weeks. Effects on fibrosis progression, cirrhosis risk, hepatic decompensation, and histologic outcomes after stopping treatment have not been reported.
  • GI tolerability at Phase 3 scale: The approximately 25% adverse-event discontinuation rate at the highest Phase 2 dose (le Roux et al., 2024) is a clinically relevant signal. Phase 3 uses refined titration schedules; whether real-world tolerability improves to levels seen with pure GLP-1 agonists is unresolved.
  • Long-term effects of chronic GCGR agonism: Sustained glucagon-receptor activation over years — effects on hepatic glucose output, cardiac physiology, and blood pressure — has not been characterized. This is a pharmacological concern that pure GLP-1 programs do not share, and will require Phase 3 data and post-approval pharmacovigilance to address.
  • Optimal patient selection: Whether the dual GCGR/GLP-1R mechanism confers specific advantage in patients with high liver fat, high baseline BMI, or metabolic syndrome relative to GLP-1-only agents has not been established from comparative or biomarker-stratified data.

Related peptides

Survodutide's closest relatives in mechanism and development stage include oxyntomodulin (its natural parent hormone), retatrutide (a triple GIP/GLP-1R/GCGR agonist), and the approved GLP-1 agonists it is often compared against in the obesity and MASH space. See also semaglutide — the leading approved GLP-1 agonist for obesity and T2D — and tirzepatide — the GIP/GLP-1R dual agonist approved for T2D and obesity.

Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does survodutide improve fatty liver disease by directly activating liver cells to burn fat, even in patients who have not lost much weight?

If survodutide can treat fatty liver independently of weight loss, it could help the many MASH patients who are not obese or who cannot tolerate the appetite-suppressing side effects of GLP-1 drugs, addressing a disease with no approved treatments.

The hypothesis
Survodutide's unbalanced GCGR-biased potency relative to GLP-1R agonism preferentially drives hepatic AMP-kinase activation and mitochondrial fatty acid oxidation in steatotic hepatocytes, producing MASH improvement through a pathway distinct from the weight-loss-mediated hepatic fat reduction seen with pure GLP-1R agonists.
Why it’s plausible
The physrev reference explicitly describes survodutide as having unbalanced potency favoring glucagon receptor over GLP-1R. Glucagon-driven cAMP-PKA signaling in hepatocytes activates HSL (hormone-sensitive lipase) and promotes beta-oxidation independently of weight loss or insulin sensitization. In MASH, hepatic fat accumulation is the primary driver of inflammation and fibrosis; direct hepatic GCGR stimulation could reduce steatosis regardless of body weight, representing a mechanism separate from caloric restriction.
Why it matters
MASH treatment is a major unmet clinical need and survodutide is in Phase 3 MASH trials; distinguishing a direct hepatic mechanism from weight-loss-mediated benefit would support its use in non-obese MASH patients and refine patient selection.
Plausibility.70
Novelty.55
Impact.80
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Survodutide described as long-acting dual agonist based on glucagon sequence with unbalanced potency favoring GCGR over GLP-1R.
doi: 10.1152/physrev.00057.2024
[2]
noteSurvodutide under investigation for MASH specifically in addition to obesity and diabetes; GCGR mechanism predicted to drive hepatic fat.
[3]
sourceStructure- and function-based drug discovery for glucagon/GLP-1 receptor family with relevance to GCGR hepatic signaling.
openupdated 2026-06-05

Since alcohol and metabolic syndrome damage the liver through similar processes, could survodutide treat liver disease caused by alcohol as well as by obesity?

Alcohol-related liver disease has no approved drugs and causes thousands of deaths annually; if survodutide can be repurposed for this condition once validated in MASH, it could reach patients desperately in need of treatment options much faster than starting a new drug from scratch.

The hypothesis
Survodutide's dual GCGR/GLP-1R agonism could reduce liver fibrosis in alcohol-associated liver disease (ALD) through the same hepatic fat oxidation and anti-inflammatory pathways active in MASH, given that the downstream hepatic injury mechanisms (steatosis, lipotoxicity, HSC activation) are shared between MASH and ALD.
Why it’s plausible
MASH and ALD share pathological endpoints: hepatic steatosis, oxidative stress, and hepatic stellate cell (HSC) activation leading to fibrosis. The molecular pathways targeted by GCGR agonism (beta-oxidation, reduced lipogenesis) and GLP-1R agonism (inflammation reduction, insulin sensitization) are operative in ALD as well as MASH. Phase 3 MASH data from survodutide would de-risk the mechanism; extending to ALD would address a population with fewer treatment options and higher urgency.
Why it matters
ALD is the most common cause of liver cirrhosis in Western countries and has no approved pharmacotherapy; a GCGR/GLP-1R dual agonist already validated in MASH could be repurposed rapidly for ALD with focused clinical studies.
Plausibility.70
Novelty.45
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
noteSurvodutide in Phase 3 for MASH; mechanism targets hepatic steatosis and inflammation via GCGR and GLP-1R.
[2]
paper
Dual agonist mechanism described in context of metabolic liver disease spectrum.
doi: 10.1152/physrev.00057.2024
[3]
sourceGlucagon/GLP-1 receptor biology relevant to hepatic disease mechanisms beyond MASH.
openupdated 2026-06-05

Is the main side effect limiting how much survodutide patients can take related to the heart rather than the stomach nausea typical of GLP-1 drugs?

Knowing which side effect sets the maximum dose tells drug developers exactly what to engineer around in the next generation, potentially leading to a safer version that can be dosed high enough to fully treat liver disease without cardiovascular risk.

The hypothesis
Survodutide's adverse event profile at higher doses, including elevated glucagon-like cardiovascular effects, is attributable to off-target GCGR activation in cardiomyocytes and vascular smooth muscle rather than to GLP-1R activation, predicting that dose-limiting toxicity will be cardiovascular rather than gastrointestinal and will be mechanistically separable from the hepatic therapeutic effect.
Why it’s plausible
GCGR is expressed in cardiomyocytes and vascular smooth muscle where glucagon agonism increases heart rate and blood pressure. The Phase 3 adverse event data (physrev, fendo references) describe survodutide tolerability at lower doses as favorable but suggest dose-dependent adverse events at higher doses. Given that GCGR mediates the primary hepatic benefit, dose-limiting toxicity from cardiac GCGR activation would create a therapeutic window problem distinct from the nausea that limits GLP-1R agonists.
Why it matters
Identifying cardiovascular GCGR activation as the dose-limiting toxicity would direct research toward GCGR analogs with tissue selectivity for liver over heart, a key engineering target for next-generation MASH drugs.
Plausibility.55
Novelty.55
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
paper
Survodutide at lower doses demonstrated favorable safety; dose-dependent adverse events noted at higher doses, consistent with cardiovascular GCGR effects.
doi: 10.3389/fendo.2025.1513641
[2]
paper
Survodutide potency unbalanced toward GCGR; GCGR expressed in heart and vasculature.
doi: 10.1152/physrev.00057.2024
[3]
noteSurvodutide in Phase 3 SYNCHRONIZE program; safety profile is a key clinical question.
openupdated 2026-06-05

Is the reason survodutide acts more on the glucagon receptor than the GLP-1 receptor that it has one negatively charged building block where GLP-1 drugs have a neutral one?

If this single-residue rule is confirmed, drug designers could precisely dial up or down the liver-fat-burning versus appetite-suppressing balance in future drugs, creating tailored treatments for people who need more liver benefit or more weight loss.

The hypothesis
The single N-terminal substitution in survodutide (His2Glu: HGEGTF... vs. HAEGTF... in GLP-1) is the primary determinant of its GCGR bias, because Glu at position 2 disrupts the canonical GLP-1R N-terminal binding interaction while preserving GCGR engagement that is less sensitive to position-2 charge.
Why it’s plausible
Survodutide sequence begins HGEGTFTSDVSSYLEG..., where position 2 is Glu (E) compared to Ala (A) in GLP-1 and ecnoglutide. Glu carries a negative charge at physiological pH; the GLP-1R extracellular domain has an Arg-rich binding cleft at the receptor N-terminus that may clash with Glu at position 2, reducing GLP-1R affinity. GCGR has different electrostatics at the equivalent site and is known to tolerate varied position-2 residues. The physrev reference confirms unbalanced GCGR potency, consistent with this structural prediction.
Why it matters
If Glu-2 is confirmed as the GCGR-selectivity switch, this single position becomes a generalizable design rule for tuning GLP-1R/GCGR balance across the entire oxyntomodulin analog class.
Plausibility.50
Novelty.60
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
sequenceSurvodutide HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRX: position 2 is Glu vs. Ala in GLP-1/ecnoglutide and Gln in mazdutide; Glu introduces negative charge at key selectivity position.
[2]
paper
Survodutide described as based on glucagon peptide sequence with unbalanced potency favoring GCGR.
doi: 10.1152/physrev.00057.2024
[3]
paper
Detailed SAR at positions 1-10 of GLP-1/glucagon family defines position 2 as the primary selectivity determinant.
doi: 10.1074/jbc.m116.721977
openupdated 2026-06-05

By activating the liver to process amino acids differently, could survodutide help people lose fat without losing as much muscle as they would on a GLP-1 drug?

Losing muscle along with fat during weight loss reduces long-term metabolic health and physical strength; a drug that preserves muscle while reducing fat would be far more beneficial, especially for older patients and those trying to maintain activity levels.

The hypothesis
Survodutide's GCGR agonism stimulates glucagon-driven amino acid catabolism in the liver, which could preserve lean muscle mass during weight loss relative to GLP-1R monotherapy, because hepatic amino acid uptake driven by GCGR reduces the amino acid-sensing signal that promotes muscle catabolism.
Why it’s plausible
Glucagon is the primary regulator of hepatic amino acid catabolism (particularly alanine and glutamine as gluconeogenic substrates). GCGR activation promotes amino acid uptake by the liver, reducing circulating amino acids available for muscle protein synthesis feedback. Paradoxically, by 'clearing' amino acids hepatically, GCGR agonism may reduce the catabolic signaling that occurs when circulating amino acids fall during caloric restriction. Muscle wasting during GLP-1 agonist weight loss is a recognized clinical concern.
Why it matters
Preserving lean mass during obesity treatment is clinically important because muscle loss reduces metabolic rate and functional capacity; if survodutide's GCGR arm protects lean mass, it would have a superior body composition outcome versus pure GLP-1 agents.
Plausibility.45
Novelty.65
Impact.75
Basis · grounding2 papers · 1 computed/note
[1]
paper
Survodutide described as dual GCGR/GLP-1R agonist; glucagon biology includes amino acid metabolism as a primary hepatic function.
doi: 10.1152/physrev.00057.2024
[2]
noteSurvodutide under investigation for obesity; body composition outcomes are key differentiators in obesity drug development.
[3]
paper
Adverse event profiles and efficacy comparison across tirzepatide, retatrutide, and survodutide at various doses; safety context.
doi: 10.3389/fendo.2025.1513641
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7589980959892273 boltz-2
ranking score 0.7663209438323975 boltz-2
3-letter notation
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-X
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategycolabfold_local
runtime
predicted by
predicted at2026-05-23
citationbibtex
peptidemodel (2026). Survodutide: dual weight-loss & liver-disease drug (BI 456906) (pep-10899, v1). PeptideModel. https://peptidemodel.com/card/pep-10899
@peptide{pep10899,
  sequence = {HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRX},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 5 by signal overlap
clinical trials 24 on ct.gov · checked 2026-05-09
ct.gov trials 24
with results 2
PubMed RCT 7
by phase
6phase 12phase 22phase 3
by status
7completed1recruiting2active
references 2 papers
[2]
A Phase 2 Randomized Trial of Survodutide in MASH and Fibrosis
Sanyal AJ, Bedossa P, Fraessdorf M, Neff G, et al. New England Journal of Medicine 2024
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use