Blood-sugar-regulating peptide (Ser8-GLP-1 7-36 amide)
A lab-made variant of a natural gut hormone that helps control blood sugar; the slight chemical tweak makes it last longer in the body. Used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Named peptide fragment — synthesized for research; ClinicalTrials.gov trials registered for parent compound or class
Fork this card to add platform evidence →
Endogenous peptide fragment — receptor binding/activity established in published literature; CT.gov evidence
Fork this card to add platform evidence →
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8606312870979309 | openfold3-mlx |
| ranking score | 0.9133645296096802 | openfold3-mlx |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.654 | global PDE — lower = better |
| disorder | 0.146 | fraction disordered |
| chain pair ipTM (A, B) | 0.861 | interface quality |
▸3-letter notation
▸recipeopenfold3-mlx 0.3.1
| parameter | value |
|---|---|
| model | openfold3-mlx 0.3.1 |
| weights | aedd8f3eb814e392… |
| hardware | apple_m4_base_16gb |
| mlx version | 0.31.1 |
| python | 3.14.3 |
| random seed | 42 |
| msa strategy | colabfold |
| diffusion samples | 1 |
| runtime | 451s |
| predicted by | mlx@peptide |
| predicted at | 2026-04-23 |
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1 ▸citationbibtex
@peptide{pep10595,
sequence = {HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR},
target = {gcgr},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}