pe
pep-10576 v1 CC-BY-SA-4.0

GLP-1: the natural gut hormone behind Ozempic and all GLP-1 weight-loss drugs

A natural hormone released from the gut after eating that tells the pancreas to release insulin and signals the brain to reduce appetite; the parent molecule of all GLP-1-based diabetes and weight-loss drugs such as semaglutide and liraglutide. Not itself a drug, used as a research reference.

statussynthesized targetGCGR length36 aa refs5
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.726
pTM0.696
avg pLDDT50.7
ranking score0.799
STRUCTURE · PEP-10576 × GCGR
ranking0.799
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence36 aa
1510152025303536
HDEFERHAEGTFTSDVSS YLEGQAAKEFIAWLVKGR
in the news 24 articles
overview readme

What this is

GLP-1(1-36) amide is the full-length form of glucagon-like peptide-1 — a 36-amino-acid fragment cut out of a larger precursor protein called proglucagon. It is not itself a drug, but it is the parent molecule of the entire GLP-1 receptor agonist class — liraglutide, semaglutide, dulaglutide, exenatide and their relatives — every one of which mimics or extends the action of the shorter, biologically active fragment GLP-1(7-36) amide that circulates in human blood after a meal. The sequence stored on this card (HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR) is the 36-residue primary fragment; in living tissue, the first six residues (HDEFER) are removed by prohormone convertases to yield the active GLP-1(7-36) form, and the C-terminus is amidated (–NH₂) — neither modification is visible in the raw one-letter sequence but both are essential for stability and receptor activity.

History

The existence of glucagon-like sequences within the proglucagon gene was revealed by molecular cloning of proglucagon in the early 1980s, but the physiological role of these "glucagon-like" peptides was not understood until later in the decade. Drucker and colleagues (1987) demonstrated that GLP-1 stimulates insulin gene expression and raises intracellular cyclic AMP in a rat islet cell line — the first direct molecular evidence that GLP-1 is a glucose-dependent incretin (Drucker, PNAS, 1987). The cloning of the human glucagon receptor (GCGR) by Macneil and colleagues (1994) mapped the receptor landscape through which proglucagon-derived peptides signal (Macneil, Biochem Biophys Res Commun, 1994). The structural determinants of how GLP-1 engages the transmembrane domain of its receptor were characterized by Yang and colleagues (2016), informing the rational design of long-acting analogs (Yang, J Biol Chem, 2016). Three decades of work on this hormone culminated in the GLP-1 receptor agonist class that now dominates type-2 diabetes and obesity pharmacotherapy.

What it does

GLP-1 acts at the GLP-1 receptor (GLP-1R), a class B GPCR expressed on pancreatic beta cells, gut vagal afferents, and neurons in the brainstem and hypothalamus. When blood glucose rises after a meal, GLP-1 released from intestinal L-cells stimulates insulin secretion in a strictly glucose-dependent manner — meaning it amplifies insulin release only when glucose is already elevated, which is why GLP-1-based therapies carry a low intrinsic risk of hypoglycemia. GLP-1 also slows gastric emptying, suppresses glucagon secretion from pancreatic alpha cells, and signals satiety to appetite-regulating centres in the brain. The full-length GLP-1(1-36) form represented on this card is the precursor; in vivo it is trimmed to GLP-1(7-36) amide, which is the principal circulating active form and the molecule most pharmacological research focuses on. The closely related peptide oxyntomodulin — also a proglucagon product — activates both GLP-1R and the glucagon receptor (GCGR), producing appetite suppression and increased energy expenditure through dual receptor engagement (Shankar, Diabetes, 2018; Pocai, Molecular Metabolism, 2014).

Evidence

  • Human: GLP-1(7-36) amide and its synthetic long-acting analogs have been tested in thousands of human studies. The active fragment forms the pharmacological basis of every approved GLP-1 receptor agonist. Native GLP-1 infusion studies in humans have confirmed its glucose-dependent insulinotropic and appetite-suppressing effects. Shankar and colleagues (2018) used graded glucose-infusion procedures in overweight and obese subjects with and without type-2 diabetes to show that native oxyntomodulin — a related proglucagon product — has significant glucoregulatory effects independent of weight loss (Shankar, Diabetes, 2018).
  • Animal: Extensively studied in rodent models of diabetes and obesity. GLP-1 receptor signaling in rat islet cell lines was among the earliest demonstrations of its insulin-stimulating mechanism (Drucker, PNAS, 1987).
  • In vitro: Receptor-binding and signaling studies in recombinant cell systems have characterized GLP-1R engagement, including structural work on the seven-transmembrane binding domain (Yang, J Biol Chem, 2016) and earlier work identifying the closely related glucagon receptor through which related proglucagon peptides signal (Macneil, Biochem Biophys Res Commun, 1994).

Known effects

  • Glucose-dependent insulin secretion — Well established; the defining incretin mechanism, demonstrated in vitro and in human infusion studies (Drucker, PNAS, 1987).
  • Glucagon suppression — Documented in human studies; GLP-1 inhibits postprandial alpha-cell glucagon release.
  • Slowed gastric emptying — Observed in human studies with GLP-1 infusion; contributes to postprandial glucose control.
  • Appetite suppression and satiety signaling — Demonstrated in rodent and human studies; basis for the weight-management indication of GLP-1 receptor agonist drugs.
  • Beta-cell cytoprotection — Preclinical evidence that GLP-1 receptor activation reduces beta-cell apoptosis and may help preserve beta-cell mass.

Mechanism

GLP-1(7-36) amide, the active processed form of this sequence, engages GLP-1R through a "two-domain" binding mode characteristic of class B GPCRs: the receptor's extracellular N-terminal domain captures the C-terminal portion of the peptide, while the seven-transmembrane bundle engages the peptide's N-terminal region (Yang, J Biol Chem, 2016). Receptor activation couples preferentially to Gαs, raising intracellular cAMP in pancreatic beta cells (Drucker, PNAS, 1987); the resulting PKA-dependent cascade closes ATP-sensitive potassium channels and triggers insulin exocytosis. In parallel, GLP-1R signaling recruits β-arrestin pathways involved in receptor internalization and cytoprotection. The N-terminal six residues (HDEFER) present in GLP-1(1-36) but absent from the active GLP-1(7-36) amide are inactive at GLP-1R; their removal by prohormone convertases is required for biological activity. Once formed, the active GLP-1(7-36) amide is itself rapidly degraded in circulation by dipeptidyl peptidase-4 (DPP-4), which cleaves the N-terminal two residues to yield GLP-1(9-36), a metabolite with little affinity for GLP-1R. This degradation gives the native peptide a plasma half-life of only 1–2 minutes — which is why all approved GLP-1 receptor agonist drugs are modified (by fatty-acid conjugation, Fc fusion, or backbone substitution) to resist DPP-4 cleavage.

Regulatory status

  • US: GLP-1(1-36) itself is not a regulated drug product. It is a research and reference molecule and the parent of the GLP-1 receptor agonist class. Approved GLP-1 receptor agonist drugs — liraglutide, semaglutide, dulaglutide, exenatide, and others — are separately reviewed and regulated.
  • WADA: Native peptide hormones that stimulate insulin secretion fall under WADA's prohibited list (S2, peptide hormones, growth factors, and related substances). GLP-1(1-36) as an endogenous peptide is present physiologically; pharmacological administration would be prohibited in sport.

Related peptides

  • Glucagon (/card/pep-04430) — the other principal proglucagon-derived hormone, acting at GCGR to raise blood glucose. GLP-1 and glucagon are co-encoded in the same proglucagon precursor and processed differentially in pancreatic alpha cells (glucagon-dominant) and intestinal L-cells (GLP-1-dominant).
  • Oxyntomodulin — a proglucagon-derived peptide that contains the full glucagon sequence and activates both GLP-1R and GCGR; studied for combined appetite suppression and increased energy expenditure through dual receptor engagement (Pocai, Molecular Metabolism, 2014; Shankar, Diabetes, 2018).
  • GLP-1 receptor agonist analogs — liraglutide, semaglutide, dulaglutide, and exenatide are engineered to mimic or extend the action of GLP-1(7-36) amide. They differ in half-life, receptor-binding kinetics, and the fatty-acid or protein-fusion modifications that confer once-daily or once-weekly pharmacokinetics.
  • GLP-2 — the adjacent proglucagon-derived peptide that acts at GLP-2R to support intestinal epithelial growth and barrier function; illustrates the multifunctional nature of proglucagon processing.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.7257048487663269 openfold3-mlx
ranking score 0.798628032207489 openfold3-mlx
▸structural qualityopenfold3
0
metricvaluenote
gpde0.848global PDE — lower = better
disorder0.158fraction disordered
chain pair ipTM (A, B)0.726interface quality
▸3-letter notation
His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime468s
predicted bymlx@peptide
predicted at2026-04-23
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
▸citationbibtex
peptidemodel (2026). GLP-1: the natural gut hormone behind Ozempic and all GLP-1 weight-loss drugs (pep-10576, v1). PeptideModel. https://peptidemodel.com/card/pep-10576
@peptide{pep10576,
  sequence = {HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR},
  target   = {gcgr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 20 on ct.gov · checked 2026-05-22
ct.gov trials 20
PubMed RCT 12
by phase
4phase 11phase 22phase 43no phase
by status
8completed1active1unknown
references 5 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use