PF-08653944: Pfizer's once-monthly weight-loss injection
An experimental weight-loss injection in the same family as Ozempic, designed for once-monthly dosing; currently in clinical trials, not yet an approved drug.
- Class
- Investigational GLP-1 receptor agonist (biased, ultra-long-acting)
- Status
- Investigational — no regulatory approval identified; Phase 2b completed, Phase 3 program active
- Best-supported effect
- 12.3% placebo-adjusted body weight reduction at 28 weeks in adults with obesity (Phase 2b VESPER-3 trial, human, SC injection)
- Main caveat
- No Phase 3 readouts, no long-term safety data, no cardiovascular outcome trial data; tolerability advantage of biased GLP-1 signaling not validated in head-to-head clinical comparisons
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
PF-08653944 (also called PF'3944 or MET-097i) is Pfizer's investigational weight-loss injection, originally licensed from the biotech company Metsera. It belongs to the same family as Ozempic and Wegovy — drugs that mimic a gut hormone called GLP-1 — but was engineered around two specific goals: a plasma half-life long enough to allow once-monthly maintenance injections after an initial period of weekly dosing, and a "fully-biased" receptor profile that favors the insulin-signaling arm of the GLP-1 pathway while reducing activation of the β-arrestin pathway, which is hypothesized to contribute to GI side effects. Phase 2b evidence is available; Phase 3 is underway. As of 2026 the compound is investigational-only and is not available outside Pfizer's clinical trial program. The stored raw sequence is an approximation; the active molecule carries half-life-extending conjugation chemistry that is not represented in the single-letter sequence shown here.
What it does
PF-08653944 activates the GLP-1 receptor, which triggers glucose-dependent insulin release, suppresses glucagon, slows gastric emptying, and reduces appetite through circuits in the hindbrain and hypothalamus — the same actions that underlie the weight-loss effects of semaglutide and tirzepatide. The proposed difference is in the signaling quality: rather than activating the GLP-1 receptor in a balanced way, PF'3944 is designed to steer receptor activation toward G-protein (Gαs/cAMP) signaling and away from β-arrestin-2 recruitment. The hypothesis — grounded in receptor pharmacology — is that β-arrestin-driven internalization and sustained GI-tract activation underlie much of the nausea and GI intolerance characteristic of the GLP-1 class, and that a biased profile might reduce those effects while maintaining efficacy. Whether this translates to a meaningful tolerability advantage in humans has not yet been established in head-to-head clinical comparisons. The second distinguishing feature is dosing cadence: after a weekly titration phase, the extended half-life supports monthly maintenance injections, a departure from the weekly cadence of semaglutide and tirzepatide.
Evidence
- Human: Phase 2b only. The VESPER-3 trial (2026) enrolled adults with obesity and used a weekly titration period through week 12 followed by monthly maintenance dosing; the trial reported 12.3% placebo-adjusted body weight reduction at 28 weeks, with weight loss continuing through the weekly-to-monthly transition. Madsbad and colleagues (2025) reviewed the Phase 2–3 pipeline for GLP-1 receptor agonists in obesity, situating this compound among the emerging long-acting candidates. No Phase 3 efficacy or safety readouts are available. No cardiovascular outcomes trial data exist.
- Animal: Preclinical work is described in available literature as supporting the biased-agonism design hypothesis; specific in vivo publications from the Pfizer/Metsera development program are not individually available in the current source set.
- In vitro: Receptor pharmacology characterization of the biased-agonism profile is referenced in mechanistic context; individual assay data are not available in the current source set.
Known effects
- Weight loss (obesity) — Phase 2b (VESPER-3, 2026): 12.3% placebo-adjusted reduction at 28 weeks
- Monthly dosing feasibility — Phase 2b: weight loss continued through weekly-to-monthly cadence transition; all-monthly regimen under investigation in Phase 3 VESPER-6
- Glycemic control (type 2 diabetes) — Phase 3 planned (VESPER-5); no efficacy data yet
- Biased GLP-1R agonism (tolerability hypothesis) — Mechanistic only; not validated in head-to-head clinical comparisons
Safety signals
GI adverse events (nausea, diarrhea, vomiting) are expected as a class effect of GLP-1 receptor agonism and have been observed in Phase 2b, though frequency and severity relative to other long-acting GLP-1 agonists remain to be characterized in Phase 3. Injection-site reactions are expected for a monthly subcutaneous depot-style administration. No long-term safety data are available; the compound has not undergone the kind of chronic-exposure characterization that approved agents have. A cardiovascular outcome trial is planned as part of the ten-trial VESPER Phase 3 program, but results are not available. The proposed tolerability advantage of biased GLP-1 signaling — the core differentiation claim — has not been confirmed in controlled head-to-head comparisons. Gasbjerg and colleagues (2026) reviewed the physiology of proglucagon-derived peptides and the receptor-signaling basis for GLP-1 class effects, providing context for the GI-side-effect mechanism that the biased design is intended to address.
Regulatory status
- US (FDA): Not approved — investigational only. Not available outside Pfizer's clinical trial program.
- EU (EMA): No approval identified; investigational status.
- WADA: Anti-doping status not verified against the current WADA prohibited list for this card.
Mechanism
PF-08653944 is a conjugated GLP-1 analog designed to act as a biased agonist at the GLP-1 receptor (GLP-1R). Binding to GLP-1R on pancreatic β-cells potentiates glucose-dependent insulin secretion; receptor activation also suppresses glucagon release, slows gastric emptying, and reduces appetite via hindbrain and hypothalamic circuits. These are canonical GLP-1R agonist effects shared with semaglutide and tirzepatide, as reviewed in the physiology of proglucagon-derived peptides (Gasbjerg and colleagues 2026).
The distinguishing receptor pharmacology is biased agonism: PF'3944 is engineered to preferentially stabilize GLP-1R conformations that favor G-protein (Gαs/cAMP) coupling while minimizing β-arrestin-2 recruitment. The pharmacological rationale is that β-arrestin-mediated receptor internalization and downstream GI-tract signaling contribute disproportionately to the nausea and vomiting common across the GLP-1 class, and that preserving the Gαs/cAMP arm while reducing β-arrestin engagement may maintain insulinotropic and appetite-suppressing effects with a better GI tolerability profile. This hypothesis is supported by receptor pharmacology and preclinical work cited in development-program literature, but remains unconfirmed in controlled head-to-head human comparisons.
The extended plasma half-life — enabling monthly maintenance dosing — is achieved through conjugation engineering; the specific conjugation chemistry is not individually described in sources available for this card. The raw sequence stored on this platform is the backbone approximation; the half-life-extending modification is not represented in it. Phase 2b data from VESPER-3 showed continued weight loss through the planned weekly-to-monthly dosing transition, providing pharmacokinetic support for the monthly-cadence hypothesis.
Open questions
- Phase 3 efficacy confirmation: VESPER-3 is a Phase 2b dose-finding trial. Whether 12.3% placebo-adjusted weight loss at 28 weeks holds in larger Phase 3 populations, and how the effect size compares to semaglutide or tirzepatide, remains to be established (Madsbad and colleagues 2025).
- Biased-agonism tolerability: The claim that G-protein-biased GLP-1R signaling reduces GI adverse events relative to unbiased long-acting GLP-1 agonists is pharmacologically motivated but not clinically validated. Head-to-head comparative data are absent.
- All-monthly regimen (VESPER-6): Whether an all-monthly dosing design without a weekly titration phase achieves equivalent weight loss and tolerability to the titrated VESPER-3 regimen is unknown.
- Cardiovascular outcomes: A cardiovascular outcome trial is planned as part of the ten-trial VESPER Phase 3 program; no data are available.
- Glycemic efficacy in type 2 diabetes: VESPER-5 is planned but not reported; no glycemic efficacy data exist for this compound.
- Long-term metabolic effects: The effects of sustained monthly pulsatile GLP-1R activation on lean-mass preservation, weight-regain dynamics after cessation, and metabolic adaptation are not yet characterized.
Related peptides
PF-08653944 is one of several long-acting GLP-1 receptor agonists in or near the clinic. For the established weekly GLP-1R agonist most widely used for obesity, see semaglutide. For the dual GLP-1R/GIPR agonist with Phase 3 and approval data, see tirzepatide. For context on the proglucagon peptide family that GLP-1 belongs to, the review by Gasbjerg and colleagues (Physiological Reviews, 2026) covers the full lineage from glucagon through GLP-1 and GLP-2.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Is the stomach really where GLP-1 drugs cause nausea, or does it come from the brain, and if so, does this drug's special design actually help where it matters?
If nausea from GLP-1 drugs is primarily a brain problem rather than a gut problem, drugs engineered to fix the gut signal may still cause just as much nausea. Clarifying this could save enormous resources in clinical development and lead to a better design strategy for the next generation of weight-loss drugs.
Could this drug appear to preferentially activate one signaling pathway just because it binds its receptor more slowly and stays attached longer, rather than because of something special about its molecular shape?
Understanding whether this drug's beneficial profile comes from its shape or its stickiness would guide development of the next generation of GLP-1 drugs, and could determine whether the same approach can be applied to faster-acting formulations without losing the tolerability advantage.
Does this new weight-loss drug work on two different hormone receptors at once, and if so, is the second one responsible for some of its extra effectiveness?
If this drug has dual receptor activity, patients and doctors would have a clearer picture of why it works, which diseases it might help beyond obesity, such as fatty liver disease where glucagon signaling matters, and which patients are most likely to respond.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.6420004963874817 | boltz-2 |
| ranking score | 0.7616766095161438 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | colabfold_local |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep10925,
sequence = {HSQGTFTSDVSSYLEGQAAKEFIAWLVKGRX},
target = {gcgr},
author = {peptidemodel},
year = {2026},
status = {computed}
}