pe
pep-10511 v1 CC-BY-SA-4.0

Bone-and-calcium research peptide (CT1, salmon calcitonin fragment)

A lab-made piece of salmon calcitonin, a hormone that helps control calcium levels and slows bone breakdown; used only as a research tool to study how the calcitonin receptor works.

statussynthesized targetCALCR length32 aa refs5
snapshot sparse 0% confidence
Class
Calcitonin/CGRP family peptide (fish-derived)
Status
No approved therapeutic status identified
Best-supported effect
Identified as a calcitonin-family member in medaka fish via comparative genomic analysis; no bioactivity evidence is attached to this card
Main caveat
No functional, pharmacological, or bioactivity data are present in this card's source file
status 4 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.848
pTM0.732
avg pLDDT52.5
ranking score0.929
STRUCTURE · PEP-10511 × CALCR
ranking0.929
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence32 aa
15101520253032
CSNLSTCVLGKLSQEL HKLQTFPRTNVGAGTP
in the news 20 articles
overview readme

What this is

The CT1 peptide is a 32-residue analog of salmon calcitonin (sCT), the fish-derived form of a hormone that vertebrates use to regulate calcium levels and bone resorption. Salmon calcitonin has been studied intensively as a pharmacological tool and approved medicine because it binds the human calcitonin receptor (CTR) with considerably greater potency than the human version of the hormone. The CT1 designation identifies this as a research-grade calcitonin variant used to probe receptor binding and compare activity with related peptides — notably amylin, which shares the same receptor family and is relevant to newer approaches in metabolic disease. The stored sequence carries Cys residues at positions 1 and 7 that, in the active hormone, form a disulfide ring; the C-terminal amide (-NH₂) present in pharmacologically characterized salmon calcitonin preparations is also absent from the raw stored sequence.

History

Calcitonin was first characterized in 1962 by Copp and Cheney, who isolated the hormone from the ultimobranchial gland of fish. Subsequent work established that salmon calcitonin differs substantially from human calcitonin in amino acid sequence — the two share roughly 50% sequence homology — and that the salmon form binds the human CTR with markedly higher affinity and produces prolonged receptor signaling compared with the human peptide (Furness and colleagues, as summarized in Barwell et al. 2012). The salmon variant became the preferred form in both clinical medicine and laboratory investigation. On the clinical side, salmon calcitonin reached FDA approval for postmenopausal osteoporosis, Paget's disease of bone, and hypercalcemic emergencies (brand names Miacalcin and Fortical). On the research side, sCT and its truncated fragments have been used systematically to map which parts of the peptide drive receptor binding versus receptor activation. The evolutionary origins of the calcitonin/CGRP peptide family across vertebrate lineages were traced by comparative genomic analyses, which showed calcitonin, CGRP, amylin, and adrenomedullin diverging from a common ancestral gene early in vertebrate evolution (Ogoshi et al. 2006).

What it does

The CT1 peptide binds the calcitonin receptor (CTR), a class B G protein-coupled receptor expressed prominently on osteoclasts — the bone-resorbing cells — as well as in kidney and the central nervous system. When calcitonin engages CTR on osteoclasts, the cells rapidly retract their ruffled borders, reduce motility, and halt bone resorption. The signaling cascade is primarily through Gs activation, leading to cAMP accumulation and protein kinase A (PKA) activity, with a secondary arm through intracellular calcium. In kidney, the receptor engagement increases renal excretion of calcium, contributing to the hypocalcemic effect. In laboratory settings, the CT1 sequence and closely related sCT fragments are used as competitive binding tools to define which receptor conformations are accessible to calcitonin-type versus amylin-type ligands, and to understand how receptor activity-modifying proteins (RAMPs) reshape the pharmacology of the CTR complex.

Evidence

  • Human: Salmon calcitonin (as Miacalcin/Fortical) has been evaluated in multiple clinical trials and is FDA-approved for postmenopausal osteoporosis, Paget's disease of bone, and hypercalcemia. Clinical effects include reduction in osteoclast-mediated bone resorption and hypocalcemia. The CT1 research peptide itself has not been tested in human trials.
  • Animal: In rodent models, calcitonin inhibits osteoclast formation independently of RANKL/NF-κB transcriptional pathways, as shown in mouse haematopoietic cell studies. CTR mRNA was found to be induced by RANKL during osteoclast differentiation from bone marrow macrophages while CLR expression was simultaneously downregulated, establishing CTR as an osteoclast-specific marker (Granholm et al. 2008).
  • In vitro: Lee and colleagues (2016) used purified CTR extracellular domain (ECD) and AlphaLISA competition assays to map the binding modes of calcitonin and amylin peptides. sCT fragments including the C-terminal minimal binding region were characterized against CTR and RAMP-complexed variants (AMY1, AMY2). RAMP1 and RAMP2 were shown to enhance amylin binding to CTR through allosteric mechanisms rather than direct peptide contacts (Lee et al. 2016). A separate structural study determined the crystal structure of the human CTR ECD bound to [BrPhe22]sCT(8–32) at 2.1 Å resolution, revealing the two-domain binding mechanism used by class B GPCRs (Barwell et al. 2012).

Known effects

  • Inhibition of bone resorption — Established mechanism via CTR on osteoclasts; basis for clinical use in osteoporosis and Paget's disease
  • Hypocalcemia — Via osteoclast inhibition and increased renal calcium excretion; basis for hypercalcemia indication
  • CTR receptor tool — Widely used in vitro to characterize CTR binding, two-domain activation mechanism, and RAMP-mediated receptor switching between calcitonin-type and amylin-type pharmacology
  • Ligand-bias marker — Salmon calcitonin shows markedly prolonged CTR signaling (cAMP and β-arrestin recruitment maintained for up to 72 hours) compared with human calcitonin (dissipated by 24 hours), a difference traced to slow receptor dissociation kinetics (half-life ~13 hours on cells vs. ~0.6 hours for human calcitonin)

Mechanism

The CT1 peptide acts on CTR through the two-domain binding model characteristic of class B GPCRs: the C-terminal region of the peptide (approximately residues 8–32) engages the large N-terminal extracellular domain (ECD) of CTR, positioning the N-terminal activation segment (residues 1–7) for interaction with the transmembrane bundle to initiate Gs coupling and cAMP production. Structure-activity studies with N-terminally truncated sCT fragments showed that removal of residues 1–8 shifts peptides from full agonists toward partial agonists and antagonists, with residues 3–6 forming an activation domain and residues 9–32 forming the binding domain. The Cys1-Cys7 disulfide ring at the N-terminus is not strictly required for hypocalcemic activity in rodent models, though it contributes to binding affinity and potency. The C-terminal proline (Pro-32) is essential for CTR recognition and distinguishes calcitonin-type ligands from amylin-type ligands, which carry a C-terminal tyrosine amide instead.

CTR pharmacology is further diversified by receptor activity-modifying proteins (RAMPs). CTR alone preferentially responds to calcitonin. Association of CTR with RAMP1, RAMP2, or RAMP3 generates AMY1, AMY2, and AMY3 receptors respectively, which acquire high affinity for amylin while retaining calcitonin responsiveness. The allosteric mechanism by which RAMPs tune CTR selectivity was characterized in part using sCT fragment competition assays (Lee et al. 2016; Hay et al. 2018). The calcitonin/CGRP peptide family — which includes calcitonin, α- and β-CGRP, amylin, adrenomedullin, and adrenomedullin-2/intermedin — thus operates through a combinatorial receptor system of two GPCRs (CTR and CLR) heterodimerized with three RAMPs, giving rise to six distinct receptor complexes with overlapping but distinct peptide selectivity profiles (Hay et al. 2018).

Regulatory status

  • US: Salmon calcitonin (as Miacalcin, Fortical) is FDA-approved for postmenopausal osteoporosis (at least 5 years post-menopause), Paget's disease of bone, and hypercalcemia. The CT1 research peptide is not a pharmaceutical product and carries no regulatory designation.
  • Research use: The CT1 peptide is a laboratory tool compound. It is not approved for any therapeutic application.

Related peptides

  • Amylin (islet amyloid polypeptide) — co-agonist of CTR-based receptors; shares the CTR/RAMP complex pharmacology studied with CT1 fragments. See also pramlintide, the approved amylin analog.
  • CGRP (calcitonin gene-related peptide) — related family member that preferentially binds the CLR/RAMP1 complex (CGRP receptor) rather than CTR alone; the CT/CGRP family traces to a common vertebrate ancestral gene (Ogoshi et al. 2006).
  • Adrenomedullin — another calcitonin/CGRP family member acting primarily through CLR/RAMP2 and CLR/RAMP3 complexes; reviewed in the same IUPHAR pharmacology update (Hay et al. 2018).
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.8482126593589783 openfold3-mlx
ranking score 0.9286485314369202 openfold3-mlx
▸structural qualityopenfold3
0
metricvaluenote
gpde0.748global PDE — lower = better
disorder0.208fraction disordered
chain pair ipTM (A, B)0.848interface quality
▸3-letter notation
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Phe-Pro-Arg-Thr-Asn-Val-Gly-Ala-Gly-Thr-Pro
▸recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime453s
predicted bymlx@peptide
predicted at2026-04-25
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
▸citationbibtex
peptidemodel (2026). Bone-and-calcium research peptide (CT1, salmon calcitonin fragment) (pep-10511, v1). PeptideModel. https://peptidemodel.com/card/pep-10511
@peptide{pep10511,
  sequence = {CSNLSTCVLGKLSQELHKLQTFPRTNVGAGTP},
  target   = {calcr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 0 trials · checked 2026-05-09
0
no registered clinical trials as of 2026-05-09; we'll re-check periodically
references 5 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use