pe
pep-10506 v1 CC-BY-SA-4.0

Bone-signaling research tool (Tyr36-PTHrP 1-36)

A lab-only synthetic piece of a natural bone-regulating protein, modified to carry a radioactive tag so scientists can track how bone cells receive bone-building signals. Research use only.

statussynthesized targetPTH1R length36 aa refs6
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.884
pTM0.694
avg pLDDT58.1
ranking score0.642
STRUCTURE · PEP-10506 × PTH1R
ranking0.642
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence36 aa
1510152025303536
AVSEHQLLHDKGKSIQDL RRRFFLHHLIAEIHTAEY
in the news 1 article
overview readme

What this is

(Tyr36)-PTHrP(1-36) is a research-grade synthetic version of the first 36 amino acids of parathyroid hormone-related protein (PTHrP), with the natural C-terminal residue replaced by tyrosine. PTHrP itself is a protein your body makes; its N-terminal fragment looks and acts much like parathyroid hormone (PTH) because both bind the same receptor (PTH1R) on bone and kidney cells (Gardella 2015). The added tyrosine at position 36 carries an aromatic ring that can be tagged with radioactive iodine, so this analog is used in laboratories as a radioligand and tool compound for studying how PTH-family ligands engage their receptor — not as a therapeutic.

History

PTHrP was identified in the late 1980s as the protein responsible for humoral hypercalcemia of malignancy, and was soon recognized as a normal regulator of calcium homeostasis, bone formation, and many developmental processes through the shared PTH/PTHrP receptor (Gardella 2015; Lee 2009). The therapeutic interest in PTH and PTHrP N-terminal fragments grew through the 1990s as it became clear that intermittent receptor activation could build bone rather than break it down — a path that culminated in teriparatide (recombinant human PTH 1-34), whose development history Marcus (2011) recounts as a personal reminiscence of the field. (Tyr36)-PTHrP(1-36) belongs to a family of tyrosine-extended peptide tools that came out of this same era of receptor pharmacology, designed to give researchers a tractable handle on the PTH1R signaling system.

What it does

When (Tyr36)-PTHrP(1-36) binds PTH1R, it triggers the same receptor as native PTH and PTHrP: a class B G protein–coupled receptor expressed on bone-forming osteoblasts and on kidney tubule cells. Activation drives cAMP production through Gαs and also engages calcium signaling, and these pathways together regulate calcium handling, phosphate excretion, and the balance between bone formation and resorption (Gardella 2015; Lee 2009). In cell-culture work on kidney podocytes, PTHrP(1-36) caused cAMP to accumulate and altered intracellular calcium, confirming functional PTH/PTHrP receptor signaling outside the classic bone and kidney-tubule contexts (Endlich 2001).

Mechanism

PTH1R is a class B (secretin-family) GPCR. Cryo-EM of the active human PTH1R in complex with a long-acting PTH analog and stimulatory G protein has resolved how the N-terminal residues of the ligand insert into the receptor's transmembrane bundle to stabilize the active conformation that couples to Gαs (Zhao 2019). N-terminal 1-34 and 1-36 fragments of PTH and PTHrP are sufficient for receptor activation; the C-terminal extension to residue 36 (and the appended Tyr in this analog) lies outside the core agonist pharmacophore and serves primarily as a labeling handle rather than a determinant of intrinsic activity. Different N-terminal PTH/PTHrP ligands — teriparatide (hPTH 1-34), abaloparatide (a PTHrP-based analog), and long-acting PTH — engage the receptor with comparable initial cAMP signaling but differ in how long the active receptor state persists and how the ligand-receptor complex traffics inside the cell, which helps explain their differing clinical effects on bone versus mineral metabolism (Sato 2021).

The stored 36-residue sequence shown here (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY) ends in tyrosine; that terminal Y is the (Tyr36) substitution itself and is what allows the peptide to be radioiodinated for binding assays.

Evidence

  • Human: No human trials of this specific (Tyr36)-substituted analog. Clinical evidence for PTH1R agonism as a bone-anabolic strategy comes from other family members (teriparatide, abaloparatide); the Tyr36 analog functions as a research tool, not a drug candidate (Gardella 2015; Sato 2021).
  • Animal / cell: Used in published in vitro pharmacology of PTHrP signaling — for example, PTHrP(1-36) elicits cAMP accumulation and calcium responses in cultured podocytes, demonstrating functional PTH/PTHrP receptor coupling in those cells (Endlich 2001).
  • Structural: The cryo-EM structure of active human PTH1R bound to an N-terminal PTH analog and Gs provides the structural framework for interpreting how 1-34 / 1-36 fragments of this family activate the receptor (Zhao 2019).

Regulatory status

This is a research-only peptide; it is not approved or marketed as a therapeutic in any jurisdiction. Approved PTH1R agonists used clinically for osteoporosis (teriparatide, abaloparatide) and for hypoparathyroidism (long-acting PTH) are separate molecules with their own regulatory dossiers (Sato 2021).

Related peptides

Closely related PTH-family ligands that act through the same PTH1R receptor — these are useful contrast points for understanding what (Tyr36)-PTHrP(1-36) was built to study:

  • Teriparatide (recombinant human PTH 1-34) — the prototypical PTH1R bone-anabolic agent (Marcus 2011; Sato 2021).
  • Abaloparatide — a PTHrP-based analog optimized for osteoanabolic selectivity (Sato 2021).
  • Long-acting PTH (LA-PTH) — engineered for prolonged receptor activation, used as a structural and pharmacological reference ligand (Zhao 2019; Sato 2021).
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could swapping the iodine-tagged tyrosine for a fluorine-tagged version create a more stable, longer-lasting tracer for imaging bone receptors in patients?

If it works, doctors could image how many bone receptors a patient has, which would help predict who will respond to drugs like teriparatide and monitor treatment in real time, something not currently possible with available clinical tools.

The hypothesis
Replacing Tyr36 with a non-natural fluorotyrosine in (Tyr36)-PTHrP(1-36) would yield a PTH1R radioligand with improved specific activity and reduced deiodination liability compared to the current iodinated Tyr36 analog, without disrupting PTH1R affinity.
Why it’s plausible
Radioiodination of tyrosine residues in peptide radioligands is widely used but has a known liability: in vivo deiodination by deiodinases releases free iodide, reducing imaging signal and increasing thyroid background. Fluorotyrosine analogs (e.g., 4-fluorophenylalanine, or 19F/18F-labeled variants) are resistant to enzymatic deiodination because the C-F bond is far more stable than C-I. The Tyr36 position in this peptide was introduced specifically to provide a radiolabeling handle; substituting with fluorotyrosine would preserve the aromatic ring geometry that is tolerated at this C-terminal position (as shown by the maintained PTH1R affinity of the Tyr36 analog) while eliminating deiodination. This is feasible with existing non-natural amino acid incorporation methods.
Why it matters
A deiodination-resistant PTH1R radioligand would dramatically improve the signal-to-noise of in vivo PTH1R imaging and pharmacokinetic studies, enabling quantitative PET imaging of PTH1R expression in bone metastases and primary hyperparathyroidism, which currently has no robust clinical imaging tool.
Plausibility.75
Novelty.50
Impact.75
Basis · grounding1 paper · 2 computed/notes
[1]
noteTyr36 was introduced specifically to serve as a radioiodination site for PTH1R radioligand applications
[2]
sequenceC-terminal Tyr36 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY) is a single, isolated Tyr, making site-specific substitution with fluorotyrosine straightforward without disrupting other aromatic residues
[3]
paper
Gardella review describes the use of PTHrP N-terminal radioligands in receptor characterization, establishing that C-terminal modifications at position 36 are tolerated for PTH1R binding
doi: 10.1124/pr.114.009464
openupdated 2026-06-05

Is the central part of this peptide disordered and flexible until it docks onto the bone receptor, and does the receptor itself force it to fold?

If the peptide folds only on contact with the receptor, locking it into a pre-folded shape with chemical staples could make it bind much more tightly, potentially leading to more potent and longer-lasting drugs for osteoporosis with lower doses needed.

The hypothesis
The low pLDDT (58.1) in the central helical region (residues 14-28, containing LRRRFFLHHLIAEI) is a genuine property of the free peptide in solution rather than a modeling artifact, indicating that this stretch is dynamically disordered until it contacts the PTH1R transmembrane bundle, and that helix formation is receptor-induced rather than pre-organized.
Why it’s plausible
NMR and CD spectroscopy of PTH(1-34) and PTHrP(1-34) in aqueous solution show limited helical content in the mid-region that increases substantially in membrane-mimetic environments or upon receptor contact. A pLDDT of 58.1 for the complex, where the inter-chain ipTM is high (0.884), suggests that the peptide backbone is disordered in isolation but the interface is nonetheless well-defined, a pattern consistent with induced-fit helix formation. The FFLHHLIAEI stretch is highly amphipathic and would be expected to adopt a helix only when the hydrophobic face is buried in the receptor transmembrane core.
Why it matters
If the central helix of PTHrP(1-36) is disorder-to-order upon receptor engagement rather than pre-formed, then the entropic cost of binding is high and could be reduced by stapling or helix-nucleating substitutions, a strategy to dramatically increase PTH1R agonist potency, with direct relevance to anabolic osteoporosis therapy.
Plausibility.70
Novelty.30
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
structureboltz-2 pLDDT=58.1 in context of high ipTM=0.884; low local confidence despite strong interface score is consistent with disorder-to-order transition
[2]
sequenceResidues 17-27 (FFLHHLIAEIHT) are highly amphipathic: FF, LL, II, AA on one face; HH, EI polar face; classic induced-helix pattern
[3]
paper
Gardella review discusses solution-state disorder of PTH/PTHrP peptides and receptor-induced conformational change as core feature of their pharmacology
doi: 10.1124/pr.114.009464
openupdated 2026-06-05

Does this PTHrP fragment trigger a newly identified signaling route in deep bone cells that is different from what current bone-building drugs activate?

If it does, this could explain why some patients respond better to PTHrP-based drugs than PTH-based ones, and could point the way to a next-generation osteoporosis drug that builds stronger bone with fewer side effects by targeting the right cells more precisely.

The hypothesis
The osteocyte PTH1R signaling pathway recently identified as downstream of PTH action in bone is also activated by (Tyr36)-PTHrP(1-36) in osteocytes, and this activation produces a distinct transcriptional output from that of PTH(1-34) due to the six additional C-terminal residues (35-36 versus 34) altering the receptor signaling complex assembled in the osteocyte plasma membrane.
Why it’s plausible
A new PTH1R signaling pathway in osteocytes has been described but its activation by PTHrP N-terminal analogs has not been specifically examined. Osteocytes regulate bone formation and resorption through sclerostin and RANKL; the precise ligand context (PTH versus PTHrP versus synthetic analog) may influence which downstream effectors are recruited because PTH1R is a class B GPCR whose signaling complex composition is ligand-sensitive. The 36-residue (Tyr36)-PTHrP(1-36) and the 34-residue teriparatide share the same N-terminal activation domain but differ at their C-terminal receptor-contact residues, which could bias signaling toward different G-protein/arrestin complexes in osteocytes specifically.
Why it matters
If PTHrP-derived analogs activate a distinct osteocyte signaling program compared to PTH-derived analogs, this could explain differences in bone quality observed between teriparatide and abaloparatide (a PTHrP-based therapeutic), and would identify a structural basis for designing analogs with preferential osteocyte versus osteoblast anabolic activity.
Plausibility.50
Novelty.55
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Describes a newly characterized PTH1R signaling pathway in osteocytes downstream of PTH action, with downstream events remaining incompletely characterized
doi: 10.1002/jbm4.10441
[2]
notePTHrP(1-36) and PTH1R biology described in the context of intermittent activation producing anabolic bone effects; teriparatide comparison implicit throughout
[3]
sequenceAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY: residues 1-34 overlap with teriparatide; residues 35-36 (AY) are unique to this analog and contact the receptor extracellular domain
openupdated 2026-06-05

Does the added tyrosine at position 36 cause this peptide to bind its receptor in a way that holds on longer than the natural version?

If true, this would explain why structurally similar analogs can have very different effects on bone density, and could guide the design of longer-acting drugs for osteoporosis that work with a single dose rather than daily injections.

The hypothesis
The high ipTM score (0.884) for the (Tyr36)-PTHrP(1-36)/PTH1R complex reflects preferential engagement of the receptor's R0 conformation, predicting that this analog has a longer receptor-residence time than the native PTHrP(1-36) lacking the C-terminal tyrosine.
Why it’s plausible
PTH1R exists in two agonist-binding conformations: the transient R conformation and the prolonged-signaling R0 conformation. Structural modeling of PTH/PTHrP N-terminal analogs has shown that C-terminal extensions or substitutions can shift the equilibrium toward the R0 state by anchoring helix C in the extracellular domain. A strong ipTM of 0.884 alongside a moderate pLDDT of 58.1 suggests a confident inter-chain interface despite regional backbone flexibility, consistent with R0-state engagement where the peptide N-terminus is ordered but the mid-segment is not. If Tyr36 makes a direct contact in the extracellular binding cleft, residence time would increase relative to the 36-residue native sequence.
Why it matters
Prolonged PTH1R occupancy in bone is linked to anabolic versus catabolic bone outcomes; distinguishing R versus R0 residence pharmacology of PTHrP analogs would clarify which structural features drive bone-building versus bone-resorbing signals, a distinction directly relevant to next-generation osteoporosis therapeutic design.
Plausibility.55
Novelty.40
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Gardella and Vilardaga review of PTH1R conformational states R and R0 and their pharmacological implications
doi: 10.1124/pr.114.009464
[2]
structureboltz-2 complex ipTM=0.884, pLDDT=58.1; high interface confidence with moderate backbone disorder consistent with flexible mid-region
[3]
sequenceC-terminal Tyr36 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY) provides an aromatic residue at the peptide/receptor interface boundary not present in native PTHrP(1-34)
openupdated 2026-06-05

Does swapping in a tyrosine at the end make this peptide hit only the bone receptor and not the related receptor found in the brain and other organs?

If true, researchers using this peptide would get cleaner, less ambiguous results in bone experiments, and the finding could guide the design of drugs that target bone and kidney without unwanted side effects in the brain or pancreas.

The hypothesis
The Tyr36 substitution in (Tyr36)-PTHrP(1-36) selectively reduces agonist potency at PTH2R relative to PTH1R, compared to native PTHrP(1-36), because Tyr36 introduces a steric clash in the PTH2R binding pocket that does not accommodate bulky C-terminal residues as well as PTH1R does.
Why it’s plausible
PTH2R is activated by PTH but shows markedly lower sensitivity to PTHrP than PTH1R, a difference mapped to specific extracellular domain residues. The C-terminal region of PTH-family peptides influences receptor-subtype discrimination: PTH2R has a more restricted extracellular binding groove than PTH1R. Introducing a Tyr36 (versus the native position 36 residue in the native fragment, or truncation at 34 in teriparatide) adds a bulky hydroxyphenyl group that may clash preferentially with PTH2R's tighter binding interface rather than PTH1R's. If confirmed, this means (Tyr36)-PTHrP(1-36) is a more PTH1R-selective agonist than native PTHrP(1-36), an underexplored pharmacological property of this widely-used radioligand.
Why it matters
PTH2R is expressed in brain, pancreas, and testis; unintended PTH2R agonism by PTHrP analogs used as research tools could confound experiments in those tissues. A selective PTH1R tool compound is also pharmacologically valuable for cleanly dissecting PTH1R versus PTH2R contributions to calcium signaling and bone anabolism.
Plausibility.50
Novelty.45
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Gardella and Vilardaga describe differential PTH1R vs PTH2R selectivity determinants and the role of peptide C-terminal residues in receptor discrimination
doi: 10.1124/pr.114.009464
[2]
sequenceTerminal Tyr36 (AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY) provides a hydroxyphenyl group not present in PTH(1-34) or native PTHrP truncations
[3]
notePeptide described as PTH1R tool compound; no PTH2R selectivity data referenced, suggesting this comparison has not been formally tested
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8838252425193787 boltz-2
ranking score 0.6417489647865295 boltz-2
structural qualityopenfold3
metricvaluenote
gpde1.612global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Bone-signaling research tool (Tyr36-PTHrP 1-36) (pep-10506, v1). PeptideModel. https://peptidemodel.com/card/pep-10506
@peptide{pep10506,
  sequence = {AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY},
  target   = {pth1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 72 on ct.gov · checked 2026-05-22
ct.gov trials 72
with results 26
by phase
1phase 13phase 22phase 41early phase 13no phase
by status
3completed3recruiting1active1terminated1withdrawn
references 6 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use