rhodopsin-like GPCR (class A) · human

MC2R

melanocortin-2 receptor
melanocortin 2 receptor · UniProt Q01718 · gene MC2R
cardiovascular

The adrenal cortex receptor that turns ACTH into cortisol - the only melanocortin receptor that binds ACTH exclusively (not the shorter MSH peptides). MC2R activation drives cortisol and aldosterone synthesis via PKA→StAR. Requires MRAP1 as an obligate chaperone to reach the cell surface - the only known GPCR with this requirement. Approved ACTH analogs: cosyntropin (diagnostic cortisol stimulation test), Acthar Gel (MS relapse, infantile spasms). Used for: HPA axis pharmacology, adrenal insufficiency.

browse 17 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Corticotropin (ACTH): H.P. Acthar Gel, pituitary stress hormone

SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF · 39 aa · @peptidemodel

bioassayed pep-04440 @peptidemodel refs: 2

all cards · 17 candidates against MC2R

# id title author status refs ipSAE_d0chn ♥
1 pep-10666 Melanotan I: Scenesse/Afamelanotide, skin-darkening drug for rare sun-pain disorder pe@peptidemodel
10 — 0
4 pep-10669 ACTH: the brain's stress-hormone trigger (full 39-amino-acid form) pe@peptidemodel
8 — 0
5 pep-10667 Cortisol-signaling research fragment (Acetyl-ACTH 1-17) pe@peptidemodel
8 — 0
6 pep-10684 Cortisol-signaling fragment of ACTH (residues 22: 39) pe@peptidemodel
7 — 0
7 pep-10670 ACTH stress-hormone signal (38-amino-acid form) pe@peptidemodel
7 — 0
8 pep-10718 Shark adrenal-signaling peptide (alpha-MSH II from spiny dogfish) pe@peptidemodel
10 — 0
9 pep-10668 Cortisol-trigger hormone fragment (ACTH [1-31]) pe@peptidemodel
6 — 0
10 pep-10635 ACTH tail fragment (18-39): research tool pe@peptidemodel
6 — 0
11 pep-10638 Stress-hormone fragment (Pro-opiomelanocortin [115-135]) pe@peptidemodel
5 — 0
12 pep-10637 Stress-hormone pathway probe (POMC joining peptide, mouse fragment 115-134) pe@peptidemodel
4 — 0
13 pep-10636 Stress-hormone fragment (Pro-opiomelanocortin [115-133]) pe@peptidemodel
4 — 0
14 pep-10664 Alpha-MSH: natural skin-tanning, appetite, and anti-inflammation hormone pe@peptidemodel
6 — 0
15 pep-10544 Cortisol-blocking research fragment (ACTH [7-38]) pe@peptidemodel
6 — 0
16 pep-10543 Cortisol-pathway research fragment (ACTH [7-31]) pe@peptidemodel
6 — 0
17 pep-10780 Cortisol-pathway research fragment (ACTH 7: 39) pe@peptidemodel
10 — 0
1–17 of 17

target literature · 33 curated papers

[1]
Hruby, V. et al. 2011 Expert Opinion on Drug Discovery Approaches to the rational design of selective melanocortin receptor antagonists
cited by
6
cards
[3]
Harno, E. et al. 2018 Physiological Reviews POMC: The Physiological Power of Hormone Processing
cited by
11
cards
[4]
Møller, C. et al. 2015 BMC Research Notes Melanocortin agonists stimulate lipolysis in human adipose tissue explants but not in adipocytes
cited by
1
cards
[5]
Yeo, G. et al. 2021 Molecular Metabolism The melanocortin pathway and energy homeostasis: From discovery to obesity therapy
cited by
5
cards
[6]
Ericson, M. et al. 2017 Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease Bench-top to clinical therapies: A review of melanocortin ligands from 1954 to 2016
cited by
4
cards
[8]
Fridmanis, D. et al. 2017 Frontiers in Endocrinology ACTH Receptor (MC2R) Specificity: What Do We Know About Underlying Molecular Mechanisms?
cited by
12
cards
[10]
Dall’Olmo, L. et al. 2023 Journal of Translational Medicine Alpha-melanocyte stimulating hormone (α-MSH): biology, clinical relevance and implication in melanoma
cited by
1
cards

discussion · 0 threads

No discussion threads yet.