The adrenal cortex receptor that turns ACTH into cortisol - the only melanocortin receptor that binds ACTH exclusively (not the shorter MSH peptides). MC2R activation drives cortisol and aldosterone synthesis via PKA→StAR. Requires MRAP1 as an obligate chaperone to reach the cell surface - the only known GPCR with this requirement. Approved ACTH analogs: cosyntropin (diagnostic cortisol stimulation test), Acthar Gel (MS relapse, infantile spasms). Used for: HPA axis pharmacology, adrenal insufficiency.
MC2R is the most selective of the melanocortin receptors: it binds only ACTH and responds to none of the shorter MSH peptides, making it the sole ACTH receptor in the adrenal cortex and the molecular basis of the HPA stress axis response. MC2R activation drives cortisol and aldosterone synthesis - ACTH deficiency or MC2R inactivating mutations cause familial glucocorticoid deficiency (FGD). The receptor requires MRAP1 (melanocortin receptor accessory protein 1) as an obligate chaperone for cell surface trafficking - the only GPCR known to require such a dedicated trafficking partner. ACTH analogs are approved as diagnostic and therapeutic agents. Every scaffold targeting adrenal steroidogenesis or HPA axis pharmacology engages this card.
MC2R (chromosome 18p11.21, 297 aa) is the smallest of the melanocortin receptors and the only one with absolute selectivity for ACTH - shorter MC peptides (α-MSH, β-MSH, γ-MSH) have no appreciable MC2R activity. Selectivity arises from the requirement for ACTH's N-terminal extension beyond the shared HFRW core: residues 15–18 of ACTH (Lys-Lys-Arg-Arg) make critical contacts with MC2R ECL3, and without them binding affinity drops >1000-fold. MRAP1 is an essential single-pass transmembrane accessory protein that forms antiparallel homodimers around MC2R and is required for ER exit and plasma membrane targeting - MC2R expressed without MRAP1 remains intracellular and non-functional. Signaling: Gs → adenylyl cyclase → cAMP → PKA → phosphorylation of StAR → cholesterol import into the inner mitochondrial membrane → CYP11A1 → pregnenolone → cortisol/aldosterone. Chronic ACTH stimulation also upregulates CYP17A1, CYP21A2, and CYP11B1/B2 at the transcriptional level via CREB and SF-1. Inactivating MC2R mutations (S74I, I132L, etc.) cause autosomal recessive FGD type 1, presenting as neonatal hypoglycemia, seizures, and cortisol deficiency with preserved mineralocorticoid function.
Approved ACTH analogs: cosyntropin (tetracosactide, ACTH 1-24) is approved for the cortisol stimulation test and as a short-course anti-inflammatory treatment (Synacthen Depot). Repository corticotropin injection (Acthar Gel, purified whole pituitary ACTH 1-39) is approved for acute MS relapse, infantile spasms, nephrotic syndrome, and multiple other indications - its clinical effects partially exceed pure MC2R agonism, implicating MC1R/MC3R/MC5R co-activation. For peptide research, the tractable recipes are: ACTH(1-17) truncations retaining MC2R selectivity through preservation of the Lys15-Arg18 contact residues; ACTH analogs with Aib or D-Ala substitutions for protease resistance and extended adrenal stimulation; cyclic ACTH fragments that lock the bioactive helical conformation; and biased MC2R agonists that maximize StAR/steroidogenesis outputs over receptor desensitization/downregulation for applications in adrenal insufficiency where sustained cortisol response per dose is the goal.
SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF · 39 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10666 | Melanotan I: Scenesse/Afamelanotide, skin-darkening drug for rare sun-pain disorder | pe@peptidemodel | 10 | — | 0 | |
| 2 | pep-04440 | Corticotropin (ACTH): H.P. Acthar Gel, pituitary stress hormone | pe@peptidemodel | 2 | — | 0 | |
| 3 | pep-04436 | Cosyntropin: FDA-approved adrenal function test (tetracosactide) | pe@peptidemodel | 1 | — | 0 | |
| 4 | pep-10669 | ACTH: the brain's stress-hormone trigger (full 39-amino-acid form) | pe@peptidemodel | 8 | — | 0 | |
| 5 | pep-10667 | Cortisol-signaling research fragment (Acetyl-ACTH 1-17) | pe@peptidemodel | 8 | — | 0 | |
| 6 | pep-10684 | Cortisol-signaling fragment of ACTH (residues 22: 39) | pe@peptidemodel | 7 | — | 0 | |
| 7 | pep-10670 | ACTH stress-hormone signal (38-amino-acid form) | pe@peptidemodel | 7 | — | 0 | |
| 8 | pep-10718 | Shark adrenal-signaling peptide (alpha-MSH II from spiny dogfish) | pe@peptidemodel | 10 | — | 0 | |
| 9 | pep-10668 | Cortisol-trigger hormone fragment (ACTH [1-31]) | pe@peptidemodel | 6 | — | 0 | |
| 10 | pep-10635 | ACTH tail fragment (18-39): research tool | pe@peptidemodel | 6 | — | 0 | |
| 11 | pep-10638 | Stress-hormone fragment (Pro-opiomelanocortin [115-135]) | pe@peptidemodel | 5 | — | 0 | |
| 12 | pep-10637 | Stress-hormone pathway probe (POMC joining peptide, mouse fragment 115-134) | pe@peptidemodel | 4 | — | 0 | |
| 13 | pep-10636 | Stress-hormone fragment (Pro-opiomelanocortin [115-133]) | pe@peptidemodel | 4 | — | 0 | |
| 14 | pep-10664 | Alpha-MSH: natural skin-tanning, appetite, and anti-inflammation hormone | pe@peptidemodel | 6 | — | 0 | |
| 15 | pep-10544 | Cortisol-blocking research fragment (ACTH [7-38]) | pe@peptidemodel | 6 | — | 0 | |
| 16 | pep-10543 | Cortisol-pathway research fragment (ACTH [7-31]) | pe@peptidemodel | 6 | — | 0 | |
| 17 | pep-10780 | Cortisol-pathway research fragment (ACTH 7: 39) | pe@peptidemodel | 10 | — | 0 |
No discussion threads yet.