pe
pep-10544 v1 CC-BY-SA-4.0

Cortisol-blocking research fragment (ACTH [7-38])

A lab-made fragment of the pituitary hormone ACTH that blocks the adrenal receptor responsible for cortisol production, helping scientists study how the body regulates stress hormones; used only as a lab research tool.

statussynthesized targetMC2R length32 aa refs6
snapshot sequence_only 0% confidence
Class
Endogenous peptide fragment (ACTH-derived)
Status
No approved therapeutic status identified
Main caveat
Card is based on a catalog/database entry only; no functional characterization data is present in the source file.
status 4 / 5
prediction metrics boltz-2 2.2.1
ipTM0.695
pTM0.898
avg pLDDT77.6
ranking score0.760
STRUCTURE · PEP-10544 × MC2R
ranking0.760
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence32 aa
15101520253032
FRWGKPVGKKRRPVKV YPNGAEDELAEAFPLE
overview readme

What this is

ACTH [7-38] is a 32-residue fragment of adrenocorticotropic hormone (ACTH), the pituitary hormone that normally drives cortisol production in the adrenal glands. This particular fragment is derived from porcine (pig) ACTH and covers residues 7 through 38 of the full 39-amino-acid sequence. Unlike full-length ACTH, which activates the adrenal cortex, ACTH [7-38] acts as a competitive antagonist at the melanocortin-2 receptor (MC2R) — it occupies the receptor but does not trigger the cortisol-producing response. It is used almost exclusively as a laboratory research tool to selectively block MC2R and probe how ACTH signaling works.

History

ACTH and its precursor protein proopiomelanocortin (POMC) have been studied since the 1950s. The structure of porcine POMC was established from cloned cDNA by Boileau and colleagues (Nucleic Acids Research, 1983), which provided the full porcine ACTH sequence from which this fragment is derived. As the biology of melanocortin receptors was worked out over subsequent decades, the distinct roles of different ACTH sub-sequences were dissected. The observation that removing the first six N-terminal residues of ACTH (which encode the shared HFRWG core also found in α-MSH) strips agonist activity while preserving receptor-binding created the rationale for using fragments like ACTH [7-38] as antagonist tools. The generation of MC2R knockout mice by Chida and colleagues (PNAS, 2007) established that MC2R is required for adrenal gland development, steroidogenesis, and neonatal gluconeogenesis — pharmacological dissection using ACTH fragments and antagonists like ACTH [7-38] contributed to building that picture.

What it does

Full-length ACTH binds MC2R on adrenocortical cells and triggers the production of cortisol and other steroid hormones. ACTH [7-38] binds the same receptor but does not activate it, effectively blocking the binding site against full ACTH. Experimentally, this makes it a tool for establishing how much of a measured response in a cell or tissue system is specifically driven through MC2R rather than through other melanocortin receptors. MC2R is notable for being the only melanocortin receptor that responds exclusively to ACTH — it does not respond to α-MSH or other melanocortin peptides — and understanding the structural basis of that selectivity has been a central question addressed using this type of fragment (Fridmanis and colleagues, Frontiers in Endocrinology, 2017).

Evidence

  • Human: No human data. ACTH [7-38] is a research tool and has not entered clinical development.
  • Animal: MC2R has been characterized in vivo through genetic knockout models. Chida and colleagues (PNAS, 2007) showed that MC2R-deficient mice fail to develop normal adrenocortical architecture, cannot mount a steroidogenic response to ACTH, and have impaired neonatal gluconeogenesis — establishing the receptor's physiological necessity. Pharmacological blockade using ACTH-derived antagonist fragments has been used in adrenal cell preparations to confirm MC2R specificity.
  • In vitro: ACTH [7-38] has been used in adrenal cortex cell systems to competitively inhibit ACTH-stimulated cAMP generation, confirming its MC2R antagonist properties. The broader POMC peptide family and its receptor interactions have been reviewed in depth by Harno and colleagues (Physiological Reviews, 2018) and by Cai and colleagues (Current Protein & Peptide Science, 2016).

Mechanism

MC2R is a class A (rhodopsin-family) GPCR expressed predominantly on adrenocortical cells of the zona fasciculata. When full-length ACTH binds it, the receptor couples to Gαs, raising intracellular cAMP via adenylyl cyclase. This activates protein kinase A, which phosphorylates the steroidogenic acute regulatory protein (StAR), the rate-limiting step in mitochondrial cholesterol import and steroidogenesis. MC2R is the only melanocortin receptor that does not respond to α-MSH or other POMC-derived peptides — it binds ACTH exclusively, and the molecular basis of that selectivity has been studied through mutagenesis and fragment pharmacology (Fridmanis and colleagues, Frontiers in Endocrinology, 2017). ACTH [7-38] retains enough of the ACTH sequence to occupy the MC2R binding site but lacks the N-terminal residues (SYSMEH, positions 1–6) that are required to stabilize the receptor in its active conformation. The porcine sequence stored here (FRWGKPVGKKRRPVKVYPNGAEDELAEAFPLE) differs at several positions in the C-terminal region from the human canonical sequence — the species provenance is documented in the card subtitle and should be accounted for when interpreting antagonist pharmacology in human-receptor assay systems.

Known effects

  • MC2R competitive antagonism — Pharmacological (in vitro, adrenal cell systems). Inhibits ACTH-stimulated cAMP production at MC2R without activating the receptor.
  • Adrenal steroidogenesis blockade — Preclinical (cell preparations). Suppresses cortisol production driven by exogenous ACTH in MC2R-expressing cells.

Related peptides

The full ACTH sequence (residues 1–39) is the endogenous MC2R agonist from which this fragment is derived. The N-terminal fragment ACTH [1-24] (cosyntropin/tetracosactide) is the FDA-approved synthetic analog used clinically for adrenal function testing; it retains full MC2R agonist activity because the key N-terminal residues are intact. α-MSH shares the HFRWGKPV core sequence with ACTH positions 6–13 but acts at MC1R, MC3R, and MC5R rather than MC2R.

Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Could this fragment, used to block the adrenal cortisol receptor, also bind the brain MC4R receptor that helps control appetite and stress?

If true, researchers using this fragment to isolate cortisol-pathway effects would need to account for unintended action at a brain receptor, and some past adrenal-biology results may need rechecking. It is not yet shown that the fragment binds MC4R, so this needs direct testing.

The hypothesis
ACTH [7-38] (pep-10544) retains sufficient structural determinants to bind MC4R in the hypothalamus with meaningful affinity, making it a partial or full antagonist at MC4R in addition to its established MC2R antagonism.
Why it’s plausible
Literature explicitly notes ACTH acts at MC4R with potency similar to alpha-MSH. ACTH [7-38] retains the FRWG motif (positions 7-10 of full ACTH) and the extended basic cluster KKRRPVK that contacts melanocortin receptors broadly. Loss of His6 abolishes cAMP activation but not necessarily binding. If the binding pharmacophore for MC4R overlaps with residues 7-38, this fragment could silence both adrenal and hypothalamic ACTH signaling simultaneously, with relevance to metabolic and stress-axis crosstalk.
Why it matters
If this fragment antagonizes MC4R as well as MC2R, research using ACTH [7-38] to isolate adrenal ACTH effects may be confounded by simultaneous hypothalamic interference. It would also open a dual-receptor antagonist concept for conditions driven by both adrenal and central ACTH overactivity.
Plausibility.60
Novelty.55
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
paper
ACTH acts at MC4R in the hypothalamus with a similar potency to alpha-MSH, suggesting that ACTH-derived fragments covering the MC4R pharmacophore may retain off-target activity at MC4R.
doi: 10.1152/physrev.00024.2017
[2]
sequenceSequence FRWGKPVGKKRRPVKVYPNGAEDELAEAFPLE retains the FRWG motif and KKRRPVK basic cluster that are known to contribute to melanocortin receptor binding across the MC receptor family.
[3]
structureBoltz-2 ipTM=0.695 for MC2R complex indicates moderate-confidence binding; MC4R docking may yield comparable or higher confidence given the shared pharmacophore.
openupdated 2026-06-11

Could some adrenal effects of this fragment come from a second target it binds, separate from the main MC2R receptor?

Some families have adrenal failure with a normal MC2R gene, hinting at other ACTH-responsive pathways. If this fragment acts partly outside MC2R, experiments treating it as a clean MC2R blocker may need rechecking, and a new adrenal target could emerge. The specific second target is unknown and proposed only as a possibility to test.

The hypothesis
In MC2R-knockout adrenal tissue, ACTH [7-38] loses its adrenal steroidogenic-suppression effect but retains suppression of adrenal developmental gene expression via a residual MC2R-independent mechanism, implicating a second adrenal receptor or intracellular pathway that responds to this fragment.
Why it’s plausible
The MC2R KO mouse study showed that MC2R is required for corticosterone and aldosterone synthesis, yet adrenal gene expression profiling revealed complex residual effects in POMC KO animals not fully explained by MC2R loss alone. ACTH [7-38] is routinely used as a specific MC2R blocker, but if it also engages another adrenal target (possibly a G-protein coupled receptor or toll-like receptor sensitive to cationic peptides), some of its observed effects in adrenal pharmacology studies would be misattributed to MC2R blockade.
Why it matters
If ACTH [7-38] has an MC2R-independent action in adrenal tissue, decades of experiments using it as a selective MC2R blocker may need reinterpretation. Identifying the second mechanism would also reveal a novel adrenal signaling pathway that could be targeted independently of the classical ACTH/MC2R axis.
Plausibility.50
Novelty.60
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
paper
MC2R KO mouse adrenal gene expression profiling revealed that steroidogenic gene regulation is complex and not solely dependent on MC2R, suggesting additional receptor inputs are present in adrenal tissue.
doi: 10.1073/pnas.0706953104
[2]
sequenceThe strongly basic KKRRPVK region in the fragment could interact with heparan sulfate proteoglycans, formyl peptide receptors, or other cation-sensing adrenal receptors independently of MC2R.
[3]
structureipTM=0.695 for the MC2R complex is moderate, leaving room for the possibility that some binding poses involve alternative receptor contacts not captured by the primary MC2R docking model.
openupdated 2026-06-11

Could this fragment partly block the skin pigment receptor MC1R and reduce the skin darkening seen in adrenal diseases like Addison?

Addison and Nelson disease cause heavy skin darkening with no targeted drug. If this fragment can occupy the pigment receptor without switching it on, it could point toward a treatment. Note that the fragment is missing the histidine that drives strong MC1R activity, so any blocking would likely be weak and must be tested directly.

The hypothesis
ACTH [7-38] could suppress skin hyperpigmentation in conditions of POMC overexpression (such as Addison disease and Nelson syndrome) by competitively blocking alpha-MSH and ACTH at MC1R on melanocytes, because the FRWG motif shared with alpha-MSH is retained in this fragment.
Why it’s plausible
Alpha-MSH and ACTH share the HFRWG core (residues 6-10 of ACTH), which mediates binding to MC1R on melanocytes and drives pigmentation. ACTH [7-38] begins at position 7 and retains the FRWG portion of this shared motif. In Addison disease and Nelson syndrome, elevated ACTH and POMC-derived peptides cause hyperpigmentation via MC1R. An MC2R-targeted antagonist that also partially competes at MC1R could reduce hyperpigmentation. No current therapy specifically targets this POMC-melanocyte axis.
Why it matters
If confirmed, ACTH [7-38] or a derivative could be repurposed to treat the disfiguring hyperpigmentation that is a hallmark of Addison disease and Nelson syndrome, for which there is no targeted pharmacological option. This would also validate MC1R as a second physiologically relevant target of this fragment.
Plausibility.40
Novelty.70
Impact.60
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceThe fragment begins FRWG, which is the C-terminal part of the shared HFRWG agonist core of alpha-MSH and ACTH that is required for MC1R binding and activation of melanocytes.
[2]
paper
POMC-derived peptides including ACTH and alpha-MSH act at MC1R in the skin; elevated POMC signaling in adrenal insufficiency causes hyperpigmentation via this pathway.
doi: 10.1152/physrev.00024.2017
[3]
noteREADME notes the fragment retains the FRWG sequence shared with alpha-MSH and that removing H6 strips agonist activity but not receptor engagement, consistent with competitive antagonism at MC1R as well as MC2R.
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.6948598623275757 boltz-2
ranking score 0.7595046162605286 boltz-2
▸3-letter notation
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Leu-Ala-Glu-Ala-Phe-Pro-Leu-Glu
▸recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights—
hardwarevast_v100_32gb
mlx version—
python—
random seed1
msa strategycolabfold_local
runtime—
predicted by—
predicted at2026-05-22
▸citationbibtex
peptidemodel (2026). Cortisol-blocking research fragment (ACTH [7-38]) (pep-10544, v1). PeptideModel. https://peptidemodel.com/card/pep-10544
@peptide{pep10544,
  sequence = {FRWGKPVGKKRRPVKVYPNGAEDELAEAFPLE},
  target   = {mc2r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 155 on ct.gov · 2 on EUCTR · checked 2026-05-09
ct.gov trials 155
with results 50
EUCTR 2
by phase
1phase 13phase 35phase 41no phase
by status
7completed2terminated1unknown
references 6 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use