pe
pep-10670 v1 CC-BY-SA-4.0

ACTH stress-hormone signal (38-amino-acid form)

A near-complete form of the pituitary hormone that tells the adrenal glands to make cortisol, the body's main stress hormone; used only as a lab research tool.

statussynthesized targetMC2R length38 aa refs7
snapshot sequence_only 0% confidence
Class
Peptide fragment derived from the ACTH/β-lipotropin precursor
Status
No approved therapeutic status identified
Main caveat
This card describes a sequence-identified bovine-derived peptide fragment; no bioactivity, efficacy, or safety data are attached.
status 4 / 5
prediction metrics boltz-2 2.2.1
ipTM0.668
pTM0.884
avg pLDDT76.6
ranking score0.746
STRUCTURE · PEP-10670 × MC2R
ranking0.746
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence38 aa
1510152025303538
SYSMEHFRWGKPVGKKRRP VKVYPNGAEDESAQAFPLE
overview readme

What this is

Adrenocorticotropic hormone (ACTH) is a peptide hormone released by the pituitary gland that tells the adrenal glands to produce cortisol — the body's main stress hormone. This card covers the 38-residue form, ACTH [1-38], which spans all but the final amino acid of the canonical 39-residue sequence. ACTH is an endogenous hormone encoded within a larger precursor protein called proopiomelanocortin (POMC), from which it is cleaved along with several other biologically active peptides (Harno et al., Physiological Reviews, 2018). Two synthetic forms of ACTH have medical use: cosyntropin (the first 24 residues, also called tetracosactide), used to test adrenal gland function; and repository corticotropin injection (Acthar Gel), a long-acting porcine-derived formulation used therapeutically in a narrow set of inflammatory and neurologic conditions.

History

The molecular origins of ACTH were established when Nakanishi and colleagues (Nature, 1979) cloned and sequenced the bovine cDNA encoding the full POMC precursor, revealing that ACTH, β-lipotropin, and α-MSH all arise from the same polyprotein by tissue-specific proteolytic processing. This confirmed ACTH's place in a family of melanocortin peptides sharing the N-terminal HFRW core that drives MC2R binding. The receptor specificity of ACTH at MC2R — and what distinguishes MC2R from the other four melanocortin receptors — has been the subject of sustained structural investigation; Fridmanis and colleagues (Frontiers in Endocrinology, 2017) reviewed the molecular determinants that make MC2R uniquely selective for ACTH compared with the broader melanocortin family.

What it does

ACTH is the principal hormonal driver of cortisol synthesis in the adrenal cortex. When ACTH reaches the adrenal glands, it binds the melanocortin 2 receptor (MC2R), triggering a signaling cascade that ultimately mobilizes cholesterol into the steroidogenesis pathway and drives cortisol production. Chida and colleagues (PNAS, 2007) demonstrated the essentiality of this pathway by generating MC2R-knockout mice, which showed severely impaired adrenal development, failed steroidogenesis, and neonatal metabolic defects — confirming that MC2R signaling is required for normal adrenocortical function. Because ACTH shares its N-terminal sequence with α-melanocyte-stimulating hormone and has some affinity for other melanocortin receptors (MC1R, MC3R, MC5R), research has explored whether ACTH's effects in inflammatory disease may partly involve direct receptor signaling on immune cells beyond the cortisol-mediated pathway (Cai et al., Current Protein & Peptide Science, 2016).

Evidence

  • Human: Cosyntropin (ACTH 1-24) has extensive clinical validation as the standard diagnostic agent for assessing adrenal reserve. Repository corticotropin injection (Acthar Gel, full-length ACTH) has randomized controlled trial support for infantile spasms and has been used in acute multiple sclerosis relapses and nephrotic syndrome, though the evidence base for non-infantile-spasms indications is variable. The peptidelist catalog (ACTH entry, April 2026) characterizes the overall human evidence grade as Strong for diagnostic use and infantile spasms.
  • Animal: MC2R knockout studies in mice have been central to characterizing the role of ACTH signaling in adrenal development and gluconeogenesis (Chida et al., PNAS, 2007). Extensive earlier animal work established the HPA-axis physiology underlying ACTH's action.
  • In vitro / mechanistic: The intracellular signaling cascade downstream of MC2R — Gαs coupling, cAMP elevation, protein kinase A activation — has been characterized in detail; Rodrigues and colleagues (Cellular and Molecular Life Sciences, 2015) reviewed the current state of melanocortin receptor intracellular signaling across all five receptor subtypes.

Known effects

  • Cortisol synthesis stimulation — Established physiology; MC2R-mediated cAMP/PKA/StAR pathway drives adrenocortical steroidogenesis (Chida et al., PNAS, 2007; Rodrigues et al., Cellular and Molecular Life Sciences, 2015)
  • Adrenal gland maintenance — Chronic ACTH stimulation sustains adrenocortical mass; MC2R knockout leads to adrenal hypoplasia (Chida et al., PNAS, 2007)
  • Anti-inflammatory effects (indirect and possibly direct) — Cortisol elevation accounts for most observed anti-inflammatory effects; a possible additional contribution from MC1R/MC3R signaling on leukocytes is hypothesized but not definitively established in clinical populations (Cai et al., Current Protein & Peptide Science, 2016)

Safety signals

ACTH's safety profile in clinical use reflects the downstream effects of sustained cortisol elevation, which closely parallel those of systemic glucocorticoid therapy. Prolonged ACTH exposure can produce fluid retention, hyperglycemia, hypertension, hypokalemia, mood changes, and, with chronic high-dose use, Cushingoid features and adrenal suppression on withdrawal. Because MC2R activation drives the HPA axis, the risk of adrenal suppression after discontinuing a sustained ACTH course is analogous to recovery following systemic corticosteroid therapy. Hypersensitivity reactions, including anaphylaxis, have been reported with animal-derived repository corticotropin formulations.

Regulatory status

  • US: Cosyntropin (synthetic ACTH 1-24) and repository corticotropin injection (Acthar Gel) are FDA-approved prescription medications. ACTH is not available over the counter and is not part of the compounded-peptide market.
  • EU/International: Tetracosactide (cosyntropin), sold as Synacthen in many markets, is approved across the EU, UK, Canada, Australia, and most major markets as a prescription diagnostic agent.
  • WADA: Corticotropins are prohibited under WADA's S9 class (Glucocorticoids), which covers agents stimulating endogenous glucocorticoid production. Tetracosactide is named specifically in WADA technical documents. Athletes subject to WADA rules require a therapeutic use exemption for medically indicated use.

Mechanism

ACTH is cleaved from POMC in corticotroph cells of the anterior pituitary. The POMC precursor encodes ACTH along with other melanocortin peptides and opioid precursors; tissue-specific processing determines which fragments are released, a variability comprehensively reviewed by Harno and colleagues (Physiological Reviews, 2018). ACTH binds MC2R, a Gs-coupled receptor expressed predominantly on cells of the adrenal zona fasciculata. MC2R is unique among the five melanocortin receptors in being selective for ACTH — the molecular determinants of this selectivity, including residues in the extracellular loops that distinguish MC2R from the more promiscuous MC1R, MC3R, MC4R, and MC5R, have been analyzed by Fridmanis and colleagues (Frontiers in Endocrinology, 2017). MC2R activation raises intracellular cAMP and activates protein kinase A, which phosphorylates the steroidogenic acute regulatory protein (StAR), enabling cholesterol import into the mitochondrial matrix — the rate-limiting step of steroidogenesis. This drives synthesis of cortisol (zona fasciculata) and, to a lesser extent, adrenal androgens (zona reticularis). Chronic ACTH stimulation causes adrenocortical hyperplasia. The broader melanocortin receptor family, its mutations, and phenotypic consequences across species have been characterized by Switonski and colleagues (Journal of Applied Genetics, 2013) and Cai and colleagues (Current Protein & Peptide Science, 2016).

The [1-38] form stored in this card is one residue shorter than the full canonical 39-residue hormone; the biological significance of this C-terminal truncation has not been separately characterized from the full-length peptide in the available literature.

Open questions

  • Whether ACTH's observed anti-inflammatory effects in conditions such as infantile spasms and MS relapses are wholly cortisol-mediated or include a distinguishable direct contribution from MC1R/MC3R signaling on leukocytes — the key unresolved question for repository corticotropin's therapeutic rationale.
  • Whether the [1-38] truncation compared with full-length ACTH [1-39] produces any measurable difference in MC2R binding affinity, pharmacokinetics, or downstream signaling.
  • Optimal cut-off thresholds for the cosyntropin stimulation test using modern liquid chromatography–mass spectrometry cortisol assays, where historical thresholds derived from older immunoassays may require recalibration.

Related peptides

  • α-MSH shares ACTH's N-terminal sequence (the first 13 residues) and arises from the same POMC precursor, acting at MC1R rather than MC2R — see the melanocortin family cards for comparison.
  • Cosyntropin (ACTH 1-24) is the truncated synthetic form covering the biologically active N-terminal domain; its diagnostic use in the cosyntropin stimulation test rests on the same MC2R binding determinants present in the full ACTH sequence.
Hypotheses6 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does a short stretch of positively charged building blocks help ACTH stick to the adrenal cell surface first, making it more effective at triggering the cell?

If this docking step turns out to be real, it would explain why short ACTH fragments work far worse than the full hormone in the body even when they bind the receptor just fine in a test tube. For drug designers, it would mean that any synthetic ACTH replacement needs to keep this charged patch, not just the core signaling region.

The hypothesis
The polycationic cluster K15-K16-R17-R18 in ACTH [1-38] (sequence SYSMEHFRWGKPVGK15K16R17R18PVKVYPNGAEDESAQAFPLE) is a heparan sulfate proteoglycan-binding motif that concentrates the peptide at the adrenocortical cell surface prior to MC2R engagement, and disrupting this cluster reduces apparent MC2R potency in cellular assays more than in cell-free binding assays.
Why it’s plausible
The K-K-R-R tetra-cationic sequence at positions 15-18 matches the canonical heparan sulfate-binding motif XBBXBX or XBBBXXBX (where B is basic), a motif present in growth factors, chemokines, and other hormones that concentrate ligands at cell surfaces bearing heparan sulfate proteoglycans. The adrenal zona fasciculata is rich in extracellular matrix. If this cluster mediates cell-surface pre-concentration, alanine substitutions at K15/K16/R17/R18 would reduce potency in intact cell assays (where proteoglycans are present) without proportional loss in membrane-extract or purified receptor binding assays. This is a non-obvious functional role for this basic region beyond simple electrostatic stabilization.
Why it matters
If confirmed, the cationic cluster would be a new pharmacophoric element for MC2R-targeted drug design, explaining why truncated peptides lacking this region (such as ACTH 1-14) show disproportionate potency losses in vivo, and providing a design principle for adrenal-targeted delivery of ACTH conjugates.
Plausibility.57
Novelty.73
Impact.62
Basis · grounding2 papers · 1 computed/note
[1]
sequenceResidues 15-18 are K-K-R-R (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLE), forming a dense basic patch consistent with heparan sulfate proteoglycan binding motifs
[2]
paper
MC2R extracellular loop interactions and receptor binding determinants for ACTH have been mapped; contributions from the mid-sequence basic region are not explicitly excluded
doi: 10.3389/fendo.2017.00013
[3]
paper
ACTH 11-24 was reported as a weak MC2R antagonist, suggesting the region spanning the cationic cluster contributes to receptor interaction even without the HFRW core
doi: 10.1517/17460441.2011.565743
openupdated 2026-06-05

If you rigidly constrain the shape of ACTH, could it become selective enough for the adrenal receptor that it avoids triggering receptors responsible for cardiovascular and other systemic side effects?

Current ACTH-based treatments hit multiple receptors across the body, causing unwanted effects on blood pressure, appetite, and mood. A conformationally locked version, if it works, could deliver the same adrenal benefit with far fewer systemic problems, and would also give patients a well-defined synthetic option instead of the animal-derived gel product used today.

The hypothesis
Introducing a lactam bridge between the side chains of E5 and K11 in ACTH [1-38] (flanking the HFRW core) would constrain the N-terminal helix, improve MC2R selectivity over MC4R and MC1R, and produce an adrenal-targeted agonist with reduced central melanocortin side effects compared to linear ACTH.
Why it’s plausible
The HFRW core (H6-F7-R8-W9) is shared by all melanocortin receptor-active peptides; receptor selectivity arises from flanking sequence context and conformational presentation. MC2R is unique in requiring full-length ACTH for activation and cannot be stimulated by alpha-MSH (residues 1-13) or by ACTH fragments shorter than approximately residues 1-17 at pharmacological concentrations (axis hit from 10.1517/17460441.2011.565743). This length dependence implies a conformational requirement that a constrained cyclic or stapled variant could satisfy while excluding the receptor-promiscuous open-chain conformation. A E5-K11 lactam bridge is chemically accessible by standard Fmoc SPPS, spans a single helical turn, and would enforce a turn or helix that presents the HFRW core at a defined angle. The Rodrigues et al. (2015) review documents that MC receptor cross-reactivity of agonist analogues caused AstraZeneca's AZD2820 to fail in phase I, confirming that selectivity engineering is the key unsolved problem.
Why it matters
A conformationally constrained MC2R-selective ACTH analogue would address the core limitation of melanocortin therapeutics: receptor cross-reactivity causing cardiovascular, sexual, and central side effects. It would also provide a synthetic alternative to animal-derived Acthar Gel with defined receptor selectivity and immunogenicity profile, targeting the same approved indications with a better therapeutic index.
Plausibility.53
Novelty.67
Impact.68
Basis · grounding2 papers · 1 computed/note
[1]
paper
MCR cross-reactions of agonist analogues caused serious adverse effects (AZD2820 phase I failure); MC2R selectivity over MC1R/MC3R/MC4R/MC5R is the defining engineering challenge
doi: 10.1007/s00018-014-1800-3
[2]
paper
Molecular determinants of MC2R selectivity for ACTH over shorter melanocortin peptides require flanking sequence context beyond the HFRW core
doi: 10.3389/fendo.2017.00013
[3]
sequenceE5 and K11 are separated by 6 residues flanking the HFRW core (SYSMEHFRWGK), making a single-turn lactam bridge geometrically feasible to constrain the N-terminal region
openupdated 2026-06-05

Could ACTH act directly on brain immune cells to stop infantile spasms, separate from its well-known ability to raise cortisol?

Doctors have long wondered why ACTH controls infantile spasms better than plain steroid drugs, even at equivalent cortisol levels. If a cortisol-independent brain pathway is confirmed, it would justify developing more targeted drugs for these devastating seizures and could open a path to treating other neuroinflammatory conditions without the harms that come with raising cortisol in infants.

The hypothesis
ACTH [1-38] suppresses neuroinflammation in infantile spasms through direct MC3R agonism on CNS-resident microglia and infiltrating macrophages, independent of cortisol elevation, via ERK1/2 signaling rather than the cAMP/PKA pathway that drives adrenocortical steroidogenesis.
Why it’s plausible
Repository corticotropin injection (full-length ACTH) is FDA-approved for infantile spasms and achieves effects that some investigators attribute to mechanisms beyond cortisol, because the time course and magnitude of seizure suppression do not fully track cortisol levels. The Cai et al. (Current Protein and Peptide Science, 2016) source notes MC1R and MC3R are expressed on leukocytes and that ACTH may signal directly on immune cells. The Rodrigues et al. (Cell Mol Life Sci, 2015) source documents that MC3R signals via ERK1/2 through a PI3K- and Gi/o-dependent mechanism in addition to cAMP/PKA, and that a neurotrophic role has been attributed to melanocortins. Because the HFRW core (H6-F7-R8-W9) present in ACTH [1-38] is the determinant for melanocortin receptor binding broadly, ACTH [1-38] retains the structural requirements for MC3R engagement in CNS immune cells.
Why it matters
Establishing a cortisol-independent MC3R/ERK1/2 anti-inflammatory mechanism would explain why ACTH formulations outperform equivalent glucocorticoid doses in infantile spasms, would justify developing MC3R-selective agonists as seizure therapeutics, and would provide a mechanistic rationale for ACTH use in other neuroinflammatory conditions where systemic cortisol elevation is undesirable.
Plausibility.57
Novelty.52
Impact.72
Basis · grounding2 papers · 1 computed/note
[1]
paper
MC1R and MC3R are expressed on leukocytes; ACTH has potential for direct immune cell signaling beyond cortisol-mediated effects
doi: 10.2174/1389203717666160226145330
[2]
paper
MC3R signals through ERK1/2 via PI3K and Gi/o independently of PKA; neurotrophic roles attributed to melanocortins
doi: 10.1007/s00018-014-1800-3
[3]
noteWhether ACTH anti-inflammatory effects in infantile spasms and MS relapses are wholly cortisol-mediated or include a direct MC1R/MC3R contribution is the key unresolved question for repository corticotropin's therapeutic rationale
openupdated 2026-06-05

Could ACTH act directly on vulnerable brain cells in Parkinson's disease to slow the inflammation that kills them, without involving the adrenal gland at all?

Parkinson's disease has no treatment that actually slows the loss of dopamine neurons. If ACTH can protect those neurons through a receptor found on the neurons themselves, rather than through cortisol, it would point toward a new class of neuroprotective drugs, and the parts of ACTH responsible for adrenal stimulation could potentially be trimmed away, making any future treatment safer for long-term use.

The hypothesis
ACTH [1-38], by acting at MC1R on substantia nigra dopaminergic neurons with alpha-MSH-like potency, attenuates neuroinflammation-driven dopaminergic cell loss in Parkinson's disease models in an HPA axis-independent manner.
Why it’s plausible
Physiol Rev 2018 documents that ACTH acts at MC1R in skin with potency comparable to alpha-MSH. MC1R is expressed not only on melanocytes but on neurons, including dopaminergic neurons of the substantia nigra, where it has been associated with neuroprotective signaling. Alpha-MSH itself has shown protective effects in dopaminergic neuron models via MC1R-mediated suppression of microglial activation and reduction of NF-kB-driven neuroinflammation. ACTH [1-38] retains the complete HFRW core (H6-F7-R8-W9) that is the minimal melanocortin receptor binding determinant and shares the first 13 residues (SYSMEHFRWGKPV) with alpha-MSH. Given that MC1R-knockout mice show enhanced vulnerability to neuroinflammatory insults, ACTH [1-38] could replicate alpha-MSH neuroprotection via MC1R at doses that do not maximally stimulate MC2R-driven steroidogenesis.
Why it matters
Parkinson's disease lacks disease-modifying therapies. Establishing ACTH [1-38] as an MC1R agonist with dopaminergic neuroprotective effects would repurpose a well-characterized, clinically available peptide class, and would decouple the neuroprotective activity from the adrenal steroidogenic activity, pointing toward MC1R-selective fragments as safer long-term candidates.
Plausibility.42
Novelty.43
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
ACTH acts at MC1R in skin with similar potency to alpha-MSH; POMC precursors and their derived peptides are relevant at the sites of their receptors at sufficient concentrations
doi: 10.1152/physrev.00024.2017
[2]
sequenceACTH [1-38] shares residues 1-13 (SYSMEHFRWGKPV) with alpha-MSH, preserving the HFRW melanocortin core required for MC1R binding
[3]
paper
Melanocortin receptors including MC1R are targets for multiple degenerative diseases; the melanocortin system is recognized as relevant to neurodegeneration
doi: 10.2174/1389203717666160226145330
openupdated 2026-06-05

Is there a dose of ACTH low enough to trigger brain-protective signals in the CNS while staying below the level that pumps out cortisol and causes glucocorticoid side effects?

High-dose steroids are actually harmful in traumatic brain injury and are no longer used. If a low-dose ACTH window exists where the drug activates protective pathways in the brain without significantly raising cortisol, it could offer a pharmacological neuroprotectant for a condition that currently has none, and would give researchers a concrete dose range to test in clinical trials.

The hypothesis
ACTH [1-38] at doses below the threshold for sustained adrenocortical activation is neuroprotective in acute traumatic brain injury through MC4R-mediated upregulation of neurotrophic signaling in the hypothalamus, producing outcomes separable from glucocorticoid-associated harms.
Why it’s plausible
Physiol Rev 2018 (Harno et al.) explicitly notes that ACTH acts at hypothalamic MC4R with potency comparable to alpha-MSH. MC4R is widely expressed in the CNS, including cortex and hippocampus, and melanocortin signaling through MC4R has been linked to neuroprotective pathways. Because the dose required for MC4R occupancy in the CNS may be below that required for maximal adrenocortical steroidogenesis (MC2R is expressed at high density on zona fasciculata cells and has a high ACTH affinity threshold), there could be a therapeutic window where CNS MC4R-mediated neuroprotection occurs without the glucocorticoid toxicity that has historically made corticosteroid use problematic in traumatic brain injury. The N-terminus ACTH analogue data from the immunogenicity axis (Bobyntsev et al., 2025) showing cytokine modulation in chronic stress provides corroborating evidence that ACTH-derived peptides can engage CNS immune circuits.
Why it matters
Traumatic brain injury lacks effective pharmacological neuroprotectants; identifying a dose-separated window for MC4R-based CNS protection would open a new therapeutic application for ACTH-derived molecules and justify dose-finding studies distinct from the adrenal-directed dosing used in current clinical protocols.
Plausibility.36
Novelty.42
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
ACTH acts at MC4R in the hypothalamus with potency similar to alpha-MSH, suggesting CNS activity at concentrations potentially sub-maximal for adrenocortical MC2R
doi: 10.1152/physrev.00024.2017
[2]
paper
N-terminal ACTH analogue ACTH(6-9)-PGP modulates pro-inflammatory cytokines in rats under chronic stress, demonstrating CNS immune circuit engagement by ACTH-derived sequences
doi: 10.33029/0206-4952-2025-46-5-620-627
[3]
noteACTH has some affinity for MC1R, MC3R, and MC4R beyond MC2R; research has explored direct receptor signaling on immune cells
openupdated 2026-06-05

Does the back end of the ACTH molecule actually touch the receptor and help activate it, or is it just a passive tail that can be cut off safely?

Cosyntropin, the synthetic ACTH used in a standard adrenal function test, contains only the first 24 of 38 residues. If the remaining segment turns out to contribute meaningfully to receptor activation, it would reopen questions about whether cosyntropin fully mimics the natural hormone in all contexts, and would force a rethink of the minimum fragment needed for a truly equivalent ACTH replacement drug.

The hypothesis
The C-terminal segment of ACTH [1-38] (residues 25-38, YPNGAEDESAQAFPLE) makes a direct conformational contribution to MC2R binding affinity beyond serving as an inert flexible tail, such that deletion of this segment reduces MC2R Emax more than expected from loss of the HFRW core alone.
Why it’s plausible
The Boltz-2 complex prediction yields an interface pTM of only 0.667, which is moderate and lower than the peptide-level pTM of 0.884. This divergence suggests the modeled peptide-receptor interface is not fully optimized, raising the possibility that the C-terminal acidic and amphipathic stretch (containing the DESAQ and AFPLE segments) contributes to receptor contact or allosteric stabilization of the bound conformation. The molecular determinants of MC2R selectivity have been mapped to extracellular loop residues that distinguish it from MC1R/MC3R/MC4R (Fridmanis et al., Frontiers in Endocrinology, 2017), and a complementary electrostatic surface on the C-terminus of ACTH could engage these loops.
Why it matters
If the C-terminus is pharmacophoric rather than dispensable, it redefines the minimal MC2R-binding fragment required for full agonism and changes the design premise of cosyntropin (residues 1-24), which is already in diagnostic clinical use. Discovering that residues 25-38 contribute to receptor engagement would explain why cosyntropin, despite retaining full steroidogenic activity, may differ pharmacodynamically from full-length ACTH in some assay contexts.
Plausibility.42
Novelty.33
Impact.52
Basis · grounding1 paper · 2 computed/notes
[1]
structureBoltz-2 complex iptm 0.667 vs ptm 0.884, suggesting suboptimal interface model of ACTH with MC2R
[2]
paper
Extracellular loop residues of MC2R are determinants of ACTH selectivity versus other melanocortin receptors
doi: 10.3389/fendo.2017.00013
[3]
sequenceResidues 25-38 (YPNGAEDESAQAFPLE) contain an acidic cluster (D31-E32) and hydrophobic cap (AFPLE) absent from alpha-MSH and cosyntropin
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.6675508618354797 boltz-2
ranking score 0.746398389339447 boltz-2
3-letter notation
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Gln-Ala-Phe-Pro-Leu-Glu
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategycolabfold_local
runtime
predicted by
predicted at2026-05-22
citationbibtex
peptidemodel (2026). ACTH stress-hormone signal (38-amino-acid form) (pep-10670, v1). PeptideModel. https://peptidemodel.com/card/pep-10670
@peptide{pep10670,
  sequence = {SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLE},
  target   = {mc2r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 155 on ct.gov · 2 on EUCTR · checked 2026-05-09
ct.gov trials 155
with results 50
EUCTR 2
by phase
1phase 13phase 35phase 41no phase
by status
7completed2terminated1unknown
references 7 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use