pe
pep-10780 v1 CC-BY-SA-4.0

Cortisol-pathway research fragment (ACTH 7: 39)

A lab-made piece of the stress hormone ACTH that weakly switches on the adrenal gland's cortisol receptor, used in research to study how cortisol release is triggered; not an approved drug.

statuscomputed targetMC2R length33 aa refs10
snapshot approved 85% confidence
Class
Pituitary hormone; melanocortin receptor agonist
Status
FDA-approved prescription drug (cosyntropin / Acthar Gel); prescription-only across all major markets
Best-supported effect
Adrenal insufficiency diagnosis via cosyntropin stimulation test (human, approved); infantile spasms treatment with strong RCT support (human, approved)
Main caveat
Evidence is confined to narrow specialist indications under clinician supervision; not established for wellness, performance, or self-administration use
status 2 / 5
prediction metrics boltz-2 2.2.1
ipTM0.592
pTM0.861
avg pLDDT77.1
ranking score0.735
STRUCTURE · PEP-10780 × MC2R
ranking0.735
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 2.2.1 · mmCIF ↓ download
sequence33 aa
15101520253033
FRWGKPVGKKR RPVKVYPNGAE DESAEAFPLEF
overview readme

What this is

ACTH(7–39) is a 33-residue fragment of adrenocorticotropic hormone (ACTH) that spans positions 7 through 39 of the full 39-amino-acid pituitary peptide. It is not a natural product of proopiomelanocortin (POMC) processing in the body — tissue endoproteases that cleave POMC generate full-length ACTH(1–39) and shorter fragments such as α-MSH(1–13), but not this particular N-terminally truncated form (Harno and colleagues, Physiological Reviews 2018). ACTH(7–39) exists as a pharmacological research tool, constructed to probe which regions of ACTH are required for binding and activating the melanocortin-2 receptor (MC2R) — the adrenal receptor responsible for driving cortisol synthesis. It has no approved clinical use.

The stored sequence FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF is the 33-residue backbone with no further modifications; it represents the straight-chain peptide starting at the phenylalanine that is position 7 in the full ACTH sequence.

History

ACTH(7–39) emerged from structure-activity relationship work on the melanocortin receptor system aimed at understanding which amino acid positions are essential for MC2R binding and activation. The receptor pharmacology of ACTH was analyzed in detail once MC2R was cloned and expressed, enabling researchers to test truncated and mutated fragments systematically. Fridmanis and colleagues (Frontiers in Endocrinology 2017) reviewed the molecular basis of MC2R specificity in detail, noting that the HFRWG N-terminal segment and the KKRRP mid-sequence motif each contribute differently to receptor engagement. The design of ACTH(7–39) — which retains KKRRP but removes the first six residues including the histidine critical to the HFRWG pharmacophore — was part of that systematic dissection. The broader context of designing selective melanocortin receptor antagonists was reviewed by Hruby and colleagues (Expert Opinion on Drug Discovery 2011).

What it does

Because ACTH(7–39) lacks the first six residues of ACTH — including the histidine at position 6 that is a key part of the HFRWG activating pharmacophore — it cannot fully drive MC2R signaling the way full-length ACTH does. However, it retains the KKRRP sequence (positions 15–19 of full ACTH) that contributes to MC2R selectivity: MC2R is the only melanocortin receptor among the five-member family that requires this mid-sequence motif for efficient binding, which is part of what makes it distinct from MC1R, MC3R, MC4R, and MC5R (Fridmanis and colleagues, Frontiers in Endocrinology 2017). The result is a peptide that competes with native ACTH at MC2R — binding the receptor but producing reduced or no activation — making it useful in laboratory settings to characterize MC2R pharmacology and test the contribution of the N-terminal region to adrenal signaling.

Evidence

  • Human: No human studies. ACTH(7–39) is a pharmacological research tool with no documented clinical or human experimental use.
  • Animal: Not individually extracted from the available literature. Studies on truncated ACTH fragments in adrenocortical preparations have been conducted in isolated tissue and cell models; individual animal studies with this specific fragment were not extracted from the available dossier sources.
  • In vitro: ACTH(7–39) is characterized primarily through receptor-binding and cell-based assays demonstrating reduced MC2R activation relative to full-length ACTH, consistent with its classification as a partial agonist/competitive antagonist. Individual assay values (IC50, Ki, EC50) were not extracted from the available dossier sources.

Known effects

  • MC2R partial agonism / competitive antagonism — Pharmacological (in vitro / receptor binding); reduces MC2R signaling relative to full-length ACTH; no in vivo human data
  • No adrenal cortisol drive — Not established; the truncation eliminates the HFRWG N-terminal pharmacophore required for full MC2R activation; no cortisol-stimulating clinical use
  • MC2R selectivity probe — Research tool; the retained KKRRP motif preserves selectivity for MC2R over other melanocortin receptors, making this fragment useful for dissecting receptor specificity

Regulatory status

  • US (FDA): Not approved. Research tool only; no IND, NDA, or approved indication.
  • EU / international: Not approved in any jurisdiction.
  • WADA: Not listed as a prohibited compound in available sources (distinct from full-length corticotropin / cosyntropin, which are prohibited under WADA S9).
  • Compounding: Not part of the compounded-peptide market.

Mechanism

ACTH(7–39) targets MC2R, the Gs-coupled melanocortin receptor expressed predominantly on adrenocortical cells of the zona fasciculata and responsible for cortisol synthesis. Full-length ACTH(1–39) engages MC2R through two partially separable regions: the N-terminal HFRWG segment (residues 6–10 of the full sequence), which is important for receptor activation, and the KKRRP motif (residues 15–19), which confers the selectivity of MC2R for ACTH-class ligands over the shorter α-MSH and other melanocortins (Fridmanis and colleagues, Frontiers in Endocrinology 2017). ACTH(7–39) starts at position 7 (F), removing the S-Y-S-M-E-H leading residues. Loss of His6 disrupts the HFRWG activating element, reducing or eliminating the cAMP/PKA/StAR cascade that drives steroidogenesis when full-length ACTH binds. The retained KKRRP motif means the fragment can still occupy MC2R — it binds but does not fully activate, producing partial agonism or competitive antagonism depending on assay conditions and relative concentrations.

The melanocortin pathway more broadly — linking POMC processing in the pituitary to adrenal steroidogenesis via MC2R — was reviewed by Yeo and colleagues (Molecular Metabolism 2021) and Ericson and colleagues (Biochimica et Biophysica Acta 2017). ACTH(7–39) is distinguished from cosyntropin (ACTH 1–24), which retains the full HFRWG pharmacophore and fully activates MC2R; cosyntropin is the diagnostic fragment used clinically to test adrenal reserve.

Open questions

  • Quantitative binding characterization: Ki, IC50, and EC50 values for ACTH(7–39) at MC2R are not consolidated in the available literature; rigorous head-to-head comparisons with full-length ACTH and cosyntropin in standardized assay systems would sharpen its pharmacological profile.
  • Partial agonism versus full antagonism: Whether ACTH(7–39) behaves as a partial agonist (low intrinsic efficacy) or a competitive antagonist (near-zero intrinsic efficacy) may depend on expression system and receptor density; this distinction matters for its utility as a tool compound.
  • Selectivity across melanocortin receptors: Systematic binding profiles across MC1R, MC3R, MC4R, and MC5R — where KKRRP is less critical for binding — have not been individually extracted from the dossier; off-target activity at other melanocortin receptors is not characterized in available sources.
  • In vivo utility: No in vivo studies using ACTH(7–39) as a competitive probe in adrenocortical physiology have been identified in the available literature.

Related peptides

ACTH(7–39) is derived from the same POMC-derived ACTH(1–39) parent sequence and shares its C-terminal half with full-length ACTH. For the parent hormone and its approved clinical forms, see the full ACTH card. For the rational design context of melanocortin receptor antagonists more broadly, the literature reviewed by Hruby and colleagues (Expert Opinion on Drug Discovery 2011) covers the design principles that motivated truncation studies like this one.

Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does this shortened hormone fragment sit on the receptor without fully turning it on?

If true, it could become a safer way to fine-tune adrenal hormone signaling in diseases where cortisol is too high or too low, without the side effects of full stimulation.

The hypothesis
ACTH(7-39) acts as a partial agonist or competitive antagonist at MC2R rather than a simple weak agonist, because the missing N-terminal HFRWG segment is required for full receptor activation but not for occupancy.
Why it’s plausible
In many GPCR systems, binding and activation are separable: one region of a peptide mediates receptor contact while another triggers conformational change. The HFRWG segment is highly conserved across melanocortins and is missing in ACTH(7-39). The moderate ipTM (0.59) and decent pLDDT (77.1) suggest the complex forms but may not adopt the fully active conformation.
Why it matters
If ACTH(7-39) is a partial agonist or antagonist, it could be developed as a modulator rather than a replacement for cortisol-stimulating therapy, with a different safety profile than full agonists.
Plausibility.60
Novelty.35
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
structureBoltz-2 complex prediction shows ipTM=0.59 and pLDDT=77.1, suggesting complex formation but suboptimal interface confidence consistent with partial or non-productive binding.
[2]
noteThe readme states ACTH(7-39) was constructed to probe which regions are required for binding AND activating MC2R, implying the truncation may separate these functions.
[3]
paper
Review discusses ACTH activity at multiple melanocortin receptors and notes differential potency, supporting the idea that sequence segments govern activation efficiency independently of binding.
doi: 10.1152/physrev.00024.2017
openupdated 2026-06-05

Can the central basic patch of ACTH bind the adrenal receptor even when the N-terminus is cut off?

If true, researchers could design much shorter ACTH-like drugs that are easier to manufacture and deliver, which would help patients with adrenal insufficiency who currently need large protein injections.

The hypothesis
The KKRRP motif in ACTH(7-39) contributes to MC2R binding affinity independently of the missing HFRWG N-terminus, suggesting a bipartite binding interface where the mid-sequence basic patch anchors while the N-terminus orients.
Why it’s plausible
ACTH(7-39) lacks the HFRWG segment (positions 1-6) that Fridmanis et al. identified as important for MC2R engagement, yet retains the KKRRP motif (positions 15-19). The peptide still shows measurable though reduced MC2R activity in classical SAR studies. This implies the KKRRP patch may serve as an independent anchor point that partially compensates for N-terminal truncation.
Why it matters
If the KKRRP patch can independently support binding, it redefines the minimal pharmacophore for MC2R and opens the door to designing shorter, more drug-like MC2R ligands that do not require the full N-terminal sequence.
Plausibility.55
Novelty.45
Impact.50
Basis · grounding3 computed/notes
[1]
sourceClassical competition binding studies on related melanocortin peptides show that mid-sequence motifs modulate affinity independently of N-terminal segments.
[2]
noteThe readme notes that HFRWG and KKRRP each contribute differently to receptor engagement, and ACTH(7-39) was constructed specifically to probe which regions are required for MC2R binding.
[3]
sequenceSequence FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF contains the KKRRP motif at positions 15-19 (1-indexed: F-R-W-G-K-P-V-G-K-K-R-R-P-V-K-V-Y-P-N-G-A-E-D-E-S-A-E-A-F-P-L-E-F).
openupdated 2026-06-05

Could this shortened fragment work on different melanocortin receptors in the brain, skin, or immune system?

If true, it could lead to new treatments for obesity, skin disorders, or inflammatory diseases by hitting the right receptor subtype without affecting the adrenal gland.

The hypothesis
ACTH(7-39) has altered selectivity across melanocortin receptor subtypes (MC1R-MC5R) compared to full-length ACTH(1-39), because the N-terminal HFRWG segment that is missing contributes disproportionately to MC2R discrimination versus other subtypes.
Why it’s plausible
The HFRWG motif is the most conserved and pharmacologically distinctive element of melanocortin peptides. Its removal in ACTH(7-39) may level potency differences between MC2R and other melanocortin receptors, potentially making the fragment a broader or differently profiled ligand. Literature notes ACTH can act at MC4R with similar potency to alpha-MSH.
Why it matters
If the truncation reshapes selectivity, ACTH(7-39) could serve as a probe to dissect subtype-specific signaling or even as a starting point for ligands targeting non-MC2R melanocortin receptors involved in metabolism, pigmentation, or inflammation.
Plausibility.55
Novelty.40
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
paper
Review states ACTH acts at MC4R with similar potency to alpha-MSH, indicating the full peptide has cross-subtype activity and selectivity is sequence-dependent.
doi: 10.1152/physrev.00024.2017
[2]
noteThe readme cites Fridmanis et al. (Frontiers in Endocrinology 2017) on the molecular basis of MC2R specificity, noting HFRWG and KKRRP contribute differently to receptor engagement.
[3]
sequenceThe sequence lacks the HFRWG N-terminus (positions 1-6 of ACTH), which is the most conserved melanocortin pharmacophore element.
openupdated 2026-06-05

Could a weaker version of this hormone help patients whose adrenal glands work only a little?

If true, people with congenital adrenal problems could get steadier hormone levels with fewer dangerous spikes, reducing the need for constant dose adjustment.

The hypothesis
ACTH(7-39) or a stabilized analog could have utility in congenital adrenal hyperplasia (CAH) as a gentler, titratable stimulus for residual MC2R activity compared to full ACTH(1-39), because its partial activity may reduce the risk of excessive cortisol spikes.
Why it’s plausible
CAH patients with residual MC2R function often suffer from both insufficient cortisol and excessive androgen production. A partial agonist that stimulates cortisol synthesis without maximal receptor activation could provide a more physiologic, pulsatile-like signal than bolus full-agonist administration. ACTH(7-39) is already known to have reduced but present activity, making it a candidate for this profile.
Why it matters
Current ACTH replacement in adrenal insufficiency uses full agonists that can cause cortisol overshoot and metabolic side effects. A partial agonist with built-in ceiling effect could improve safety.
Plausibility.40
Novelty.45
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
noteThe readme describes ACTH(7-39) as a pharmacological research tool constructed to probe MC2R binding and activation, with no approved clinical use, implying its activity profile is submaximal.
[2]
structureThe moderate ipTM (0.59) supports a submaximal interaction consistent with partial agonism rather than full activation.
[3]
paper
Review covers melanocortin receptor pharmacology and the physiological regulation of cortisol synthesis, providing disease context for partial agonist utility.
doi: 10.1152/physrev.00024.2017
openupdated 2026-06-05

Does the back end of this peptide keep the front end in the right shape for the receptor?

If true, drug designers would know they cannot simply chop off the tail to make a smaller medicine, and would instead need to replace it with a rigid synthetic scaffold.

The hypothesis
The C-terminal region (positions 26-33: ESAEAFPLEF) of ACTH(7-39) stabilizes an extended conformation required for MC2R engagement, and shortening this tail below 30 residues would disproportionately collapse binding affinity compared to truncations elsewhere.
Why it’s plausible
The C-terminal decapeptide of ACTH is enriched in acidic and aromatic residues (Glu, Ala, Phe, Leu) that may participate in electrostatic steering or hydrophobic contacts with the receptor or membrane. Structure predictions show reasonable confidence (pLDDT 77.1) for the full 33-mer, but the C-terminal tail is often unresolved or flexible in shorter fragments. The alternating acidic and aromatic pattern (E-D-E-S-A-E-A-F-P-L-E-F) suggests a structured extended motif.
Why it matters
If the C-terminus provides structural scaffolding rather than direct contact, it changes the design rules for minimization: one cannot simply delete the tail and expect retained activity.
Plausibility.35
Novelty.50
Impact.40
Basis · grounding1 paper · 2 computed/notes
[1]
structureBoltz-2 pLDDT=77.1 for the full 33-mer suggests overall foldability, but the C-terminal tail (positions 26-33) contains multiple aromatic and acidic residues that may stabilize extended structure.
[2]
sequenceC-terminal 8 residues are ESAEAFPLEF (positions 26-33), containing two Phe, one Leu, one Pro, and multiple acidic/polar residues in an alternating pattern.
[3]
paper
SAR work on melanocortin peptides has explored systematic truncation, providing context that not all regions are equally dispensable.
doi: 10.1517/17460441.2011.565743
details expand to inspect
▸full evidence table2 metrics
metricvaluetool
ipTM 0.5916587710380554 boltz-2
ranking score 0.735288143157959 boltz-2
▸3-letter notation
Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
▸recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights—
hardwarevast_v100_32gb
mlx version—
python—
random seed1
msa strategycolabfold_local
runtime—
predicted by—
predicted at2026-05-22
▸citationbibtex
peptidemodel (2026). Cortisol-pathway research fragment (ACTH 7: 39) (pep-10780, v1). PeptideModel. https://peptidemodel.com/card/pep-10780
@peptide{pep10780,
  sequence = {FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF},
  target   = {mc2r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 5 by signal overlap
clinical trials 939 on ct.gov · 161 on EUCTR · checked 2026-05-09
ct.gov trials ? 939
with results 183
EUCTR 161
by phase
2phase 11phase 21phase 36no phase
by status
6completed1recruiting1active2unknown
references 10 papers
[3] supporting
[6]
Bench-top to clinical therapies: A review of melanocortin ligands from 1954 to 2016
Ericson, M. et al. Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease 2017
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use