pe
pep-10669 v1 CC-BY-SA-4.0

ACTH: the brain's stress-hormone trigger (full 39-amino-acid form)

A natural pituitary hormone that signals the adrenal glands to release cortisol, the body's main stress and anti-inflammation hormone; synthetic versions are FDA-approved drugs used to test or stimulate adrenal function.

statussynthesized targetMC2R length39 aa refs8
status 4 / 5
prediction metrics boltz-2 1.0
ipTM0.592
pTM0.814
avg pLDDT75.1
ranking score0.719
STRUCTURE · PEP-10669 × MC2R
ranking0.719
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence39 aa
1510152025303539
SYSMEHFRWGKPV GKKRRPVKVYPNG AEDELAEAFPLEF
overview readme

What this is

Adrenocorticotropic hormone (ACTH; corticotropin) is a 39-amino-acid peptide hormone made by the anterior pituitary gland. It is the brain's "go" signal to the adrenal glands: when ACTH reaches the adrenal cortex it triggers release of cortisol — the body's main stress and anti-inflammatory hormone. Synthetic versions are used in medicine in two distinct ways: a 24-amino-acid fragment called cosyntropin (also tetracosactide; brand Cortrosyn or Synacthen) is the standard diagnostic agent for testing whether the adrenal glands can respond to a stimulus, and a long-acting depot formulation of the full 39-residue porcine peptide (repository corticotropin injection, sold in the United States as Acthar Gel) is used therapeutically for a narrow set of inflammatory and neurologic conditions. ACTH is not a wellness or self-administered peptide — it is prescription-only and used under specialist supervision. The stored 39-residue sequence is the linear ACTH(1-39) backbone; minor species-specific substitutions outside the active N-terminus exist — for example, Smith and colleagues (Journal of Endocrinology 1987) reported that guinea-pig ACTH carries Ala at position 24 in place of the Pro found in most other mammals, and stimulates aldosterone production above the level seen with human ACTH(1-39) or cosyntropin.

History

ACTH was isolated from anterior pituitary extracts in the early 1950s, with Choh Hao Li's group at UC Berkeley among the pioneering teams that purified and characterized its adrenocorticotropic activity (Harno et al., Physiological Reviews 2018). The complete primary structure of the precursor protein pro-opiomelanocortin (POMC) — from which ACTH and the related melanocortin and opioid peptides are all cleaved — was determined from porcine cDNA in 1983 (Boileau et al., Nucleic Acids Research 1983). The synthetic 1-24 fragment (cosyntropin/tetracosactide) was developed once the active N-terminal pharmacophore was identified and became the standard diagnostic agent because it is cheaper, less antigenic, and functionally equivalent at the receptor. The therapeutic depot formulation (Acthar Gel) was introduced as a long-acting injectable to sustain adrenal stimulation across days and gained FDA approval for a broad list of inflammatory and neurologic conditions under the regulatory regime of that era.

What it does

ACTH binds the melanocortin-2 receptor (MC2R) on cells of the adrenal cortex, driving synthesis and secretion of cortisol from the zona fasciculata and, in smaller amounts, aldosterone from the zona glomerulosa and DHEA from the zona reticularis (Chida et al., PNAS 2007; Fridmanis et al., Frontiers in Endocrinology 2017). Because ACTH shares its first thirteen amino acids with α-melanocyte-stimulating hormone (α-MSH) and has modest affinity for the other melanocortin receptors (MC1R, MC3R, MC5R), it also drives the broader melanocortin system — which explains, for example, the skin hyperpigmentation seen in untreated Addison's disease, where chronic POMC overproduction sends excess MSH-family peptides to MC1R on melanocytes. Whether this melanocortin-network activity contributes additional, cortisol-independent anti-inflammatory effects when ACTH is used therapeutically is an active and disputed question (Harno et al., Physiological Reviews 2018; Cai et al., Current Protein & Peptide Science 2016).

Mechanism

ACTH is generated in anterior pituitary corticotroph cells by prohormone-convertase cleavage of POMC, the same precursor that gives rise to the MSH peptides, β-endorphin, and other neuropeptides (Boileau et al., Nucleic Acids Research 1983; Harno et al., Physiological Reviews 2018). It binds MC2R, a Gs-coupled receptor that is unique among the melanocortin family in requiring an accessory protein, MRAP1 (melanocortin-2 receptor accessory protein), for trafficking to the cell surface and for productive ligand binding (Hinkle et al., Molecular and Cellular Endocrinology 2009; Fridmanis et al., Frontiers in Endocrinology 2017). MC2R activation raises intracellular cAMP, activates protein kinase A, and phosphorylates the steroidogenic acute regulatory protein (StAR), which shuttles cholesterol from the outer to the inner mitochondrial membrane — the rate-limiting step in steroid biosynthesis. Downstream cytochrome-P450 enzymes (CYP11A1, CYP17A1, CYP21A2, CYP11B1) convert that cholesterol to cortisol, aldosterone, and adrenal androgens depending on the adrenal zone in which they are expressed. MC2R-null mice generated by Chida and colleagues (PNAS 2007) have adrenal hypoplasia and fail to mount a corticosterone response to ACTH, confirming MC2R as the obligate receptor for ACTH-driven steroidogenesis. Structural work on related melanocortin receptors — including the MC4R structure determined by Yu and colleagues (Science 2020), which identified calcium as a cofactor for melanocortin-receptor ligand binding — has clarified how this receptor family recognizes its peptide ligands at the molecular level.

Evidence

  • Human: The cosyntropin (ACTH 1-24) stimulation test is the standard diagnostic method for evaluating adrenocortical insufficiency, with extensive validation over decades. Acthar Gel is FDA-approved for infantile spasms (where it has strong randomized-trial support), acute multiple-sclerosis exacerbations, nephrotic syndrome, and several rheumatologic conditions; the central modern question for most non-infantile-spasms indications is whether it adds clinical benefit over equivalent synthetic glucocorticoids at a fraction of the cost (Harno et al., Physiological Reviews 2018).
  • Animal: ACTH physiology has been characterized across thousands of animal experiments. Mice with inactivation of the MC2R gene have adrenal hypoplasia, defective neonatal gluconeogenesis, and a failed steroidogenic response to ACTH, formally demonstrating that MC2R is required for ACTH action on the adrenal cortex (Chida et al., PNAS 2007).
  • In vitro / molecular: ACTH binding to MC2R requires the accessory protein MRAP1 for receptor trafficking and signaling competence (Hinkle et al., Molecular and Cellular Endocrinology 2009; Fridmanis et al., Frontiers in Endocrinology 2017). Adrenal cell preparations show rapid cAMP, PKA, and StAR activation on ACTH exposure, with cortisol secretion measurable within minutes.

The first 24 residues contain the full MC2R-binding pharmacophore, which is why cosyntropin/tetracosactide retains full diagnostic potency; cross-species comparisons such as the guinea-pig Ala24 variant (Smith et al., Journal of Endocrinology 1987) illustrate that the C-terminal portion is comparatively tolerant of substitution without losing receptor activation.

Myths and misconceptions

  • "ACTH is a biohacker peptide for energy, cortisol support, or anti-aging." No. ACTH drives sustained cortisol release, which is catabolic, immunosuppressive, and worsens body composition, glucose control, and sleep with chronic exposure. It is not used in wellness or compounded-peptide protocols and does not have a self-administered use case.
  • "Acthar Gel works the same as prednisone." Most of Acthar Gel's clinical effect in inflammatory disease is explained by MC2R-driven cortisol release, which is pharmacologically very similar to giving an equivalent glucocorticoid directly. A hypothesized additional contribution from MC1R/MC3R signaling on leukocytes is supported in preclinical work (Cai et al., Current Protein & Peptide Science 2016), but whether it produces clinically distinguishable benefit at therapeutic doses is unresolved.
  • "Cosyntropin is a different drug from ACTH." Cosyntropin is a synthetic peptide comprising the first 24 amino acids of ACTH. It binds the same receptor (MC2R) and triggers the same adrenal response. The truncation removes the more immunogenic C-terminal region; biological activity is preserved because all the MC2R-binding determinants sit in the N-terminus.
  • "A normal cosyntropin stimulation test rules out all adrenal insufficiency." The standard 250 μg test is sensitive for primary adrenal insufficiency but can miss partial secondary (pituitary-origin) insufficiency because it supplies a supraphysiologic stimulus. Lower-dose variants and other dynamic tests may be needed to fully characterize HPA-axis dysfunction in central cases.

Common questions

What is the difference between cosyntropin and Acthar Gel? Cosyntropin is synthetic ACTH(1-24) — the active N-terminal fragment — used almost exclusively as a diagnostic agent in the cosyntropin stimulation test. Acthar Gel is a long-acting depot of full-length porcine ACTH(1-39) in a gelatin vehicle, used therapeutically for a narrow set of inflammatory and neurologic indications. Both ultimately bind MC2R and drive cortisol release; differences in formulation, kinetics, and the potential for non-MC2R melanocortin activity at full-length doses are what distinguish their clinical uses.

Why does Addison's disease cause hyperpigmentation? In primary adrenal insufficiency, low cortisol removes negative feedback on the pituitary. POMC processing increases, raising not just ACTH but also α-MSH and other melanocortin peptides. These activate MC1R on melanocytes, increasing eumelanin synthesis and producing the diffuse hyperpigmentation — especially in skin creases and sun-exposed areas — that is one of the classical signs of untreated Addison's.

Known effects

  • Adrenal cortisol, DHEA, and (to a lesser extent) aldosterone secretion
  • Adrenal-gland trophic effects on chronic stimulation (hypertrophy and hyperplasia; atrophy on prolonged ACTH deficiency)
  • Reduction of infantile spasms (FDA-approved indication for repository corticotropin)
  • Shortened duration of acute multiple-sclerosis relapses (FDA-approved indication)
  • Skin hyperpigmentation when chronically elevated, via cross-activity of MSH peptides at MC1R
  • Cushingoid features with chronic therapeutic exposure, mirroring exogenous glucocorticoid toxicity

Safety signals

Chronic therapeutic ACTH exposure produces the same adverse-effect profile as glucocorticoid excess, because the dominant downstream signal is cortisol elevation: hypertension, hyperglycemia, fluid retention, weight gain, skin thinning, osteoporosis, mood disturbance, and adrenal suppression on withdrawal. Short-term diagnostic cosyntropin has essentially no adverse-effect profile. Hypersensitivity reactions, including anaphylaxis, have been reported with animal-derived repository corticotropin formulations. The clinical incremental value of repository corticotropin over high-dose synthetic glucocorticoids remains disputed in most of its non-infantile-spasms indications, and pharmacoeconomic concerns about the cost of Acthar Gel relative to generic corticosteroids have driven much of the modern controversy around the drug.

Regulatory status

  • US: Cosyntropin (Cortrosyn) is FDA-approved as a diagnostic agent for adrenocortical insufficiency; generic cosyntropin is available. Repository corticotropin injection (Acthar Gel, H.P. Acthar) is FDA-approved for infantile spasms, acute MS exacerbations, nephrotic syndrome, and several rheumatologic and inflammatory conditions. Both are prescription-only.
  • EU / international: Tetracosactide (Synacthen / Synacthen Depot) is approved across most major markets for adrenal function testing and selected therapeutic indications. Full-length repository ACTH formulations are largely a US market phenomenon.
  • WADA: Corticotropins are prohibited under the S9 (Glucocorticoids) class of the WADA Prohibited List, which covers injected glucocorticoids and agents that stimulate their endogenous production; tetracosactide is named specifically.

Related peptides

  • α-MSH / Melanotan I (afamelanotide) (/card/pep-10666) — ACTH and α-MSH share the same N-terminal SYSMEHFRWGKPV core, which is the melanocortin pharmacophore. Melanotan I / afamelanotide is the synthetic α-MSH analog approved for erythropoietic protoporphyria; it activates the same melanocortin receptors (especially MC1R) that ACTH cross-reacts with.
  • Setmelanotide (Imcivree) (/card/pep-10811) — selective MC4R agonist for genetic and acquired obesity; same melanocortin receptor family as ACTH's primary target MC2R, but selective for a different receptor that sits downstream in the hypothalamic energy-balance pathway.
  • ACTH(7–39) (/card/pep-10780) — C-terminal ACTH fragment lacking the MC2R-binding N-terminus; useful comparator for separating receptor-binding determinants from the rest of the molecule.
  • CRF / CRH (/card/pep-10650) — corticotropin-releasing hormone from the hypothalamic paraventricular nucleus drives pituitary POMC processing and ACTH release; the upstream input to the HPA axis whose output ACTH represents.

Open questions

  • Whether the therapeutic effects of Acthar Gel in autoimmune conditions (nephrotic syndrome, MS, certain rheumatologic indications) are partly attributable to direct melanocortin-receptor signaling on immune cells, independent of MC2R-driven cortisol elevation — the central unresolved mechanistic question for non-infantile-spasms uses (Cai et al., Current Protein & Peptide Science 2016; Harno et al., Physiological Reviews 2018).
  • Whether selective MC1R or MC3R agonists could deliver the proposed non-glucocorticoid anti-inflammatory benefit of ACTH while separating it from the toxicity of sustained cortisol exposure.
  • How modern cortisol immunoassay and LC-MS/MS platforms should re-calibrate cosyntropin-stimulation-test cut-offs, since several long-standing thresholds were established against older assay generations.
  • Whether ACTH's adrenal-trophic and steroidogenic effects can be cleanly separated from its broader melanocortin-system cross-talk by analog engineering — relevant to designing successors to full-length repository corticotropin.
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Do residues 20-27 of ACTH act as a molecular dial that determines which of the five melanocortin receptors get activated?

If this segment controls receptor selectivity, scientists could use it as a design guide to make ACTH-based drugs that are either ultra-targeted to the adrenal gland or deliberately broader, opening new options for inflammatory diseases, metabolic conditions, and sexual function disorders.

The hypothesis
The PVKVYPNG segment of ACTH(1-39) (residues 20-27) functions as a MC3R/MC5R selectivity determinant, meaning that fragments spanning only residues 1-19 will be selective for MC2R and MC4R, while inclusion of residues 20-27 extends agonist activity to MC3R and MC5R.
Why it’s plausible
Alpha-MSH (1-13) is MC1R/MC3R/MC4R/MC5R selective. The extension to ACTH(1-24) is the classical MC2R activator. The intervening region 14-27 contains KKRRPVKVYPNG, where the YPNG tetrapeptide is structurally distinct. Crystal structures of MC4R show the binding pocket accommodates the His-Phe-Arg-Trp core but also has peripheral contacts; PVKVYPNG may sterically permit or exclude binding at each subtype, generating a selectivity profile that shifts across the ACTH fragment length series.
Why it matters
Understanding the selectivity determinant within residues 20-27 would allow rational design of ACTH-derived peptides that are MC2R-only (for pure adrenal stimulation) versus pan-melanocortin (for broader anti-inflammatory or metabolic effects).
Plausibility.50
Novelty.55
Impact.55
Basis · grounding2 papers · 1 computed/note
[1]
sequencePVKVYPNG appears at residues 20-27 of ACTH(1-39); this region is absent from alpha-MSH and from ACTH(1-17), making it a candidate selectivity determinant
[2]
paper
MC4R crystal structure with SHU9119 shows a defined binding pocket; the peripheral residues beyond the HFRWG pharmacophore contact receptor loops that differ across MC subtypes
doi: 10.1126/science.aaz8995
[3]
paper
Review notes ACTH acts at MC4R with potency similar to alpha-MSH, implying that the 1-13 core suffices for MC4R; added residues 14-39 may modulate subtype selectivity
doi: 10.1152/physrev.00024.2017
openupdated 2026-06-05

Does the long tail of ACTH just dangle uselessly when it docks to its receptor, with all the real work done by the front end?

If the tail is irrelevant for receptor activation, it would confirm that much shorter, cheaper synthetic versions of ACTH are just as effective. This matters for patients who need adrenal function tests or cortisol-stimulating treatments, as simpler drugs are easier to manufacture and afford.

The hypothesis
The low ipTM of 0.592 for full-length ACTH(1-39) with MC2R reflects the intrinsic disorder of residues 25-39 rather than a weak MC2R-binding interface, meaning the N-terminal core engages MC2R with high affinity while the C-terminus contributes no direct receptor contacts.
Why it’s plausible
Boltz-2 scores the entire complex; a disordered C-terminal tail (residues 25-39 are rich in Ala, Glu, Asp, Leu, Phe, Pro) will degrade pLDDT and ipTM even when the N-terminal 1-17 core docks canonically. This predicts that truncated forms such as ACTH(1-17) or ACTH(1-24) will show higher ipTM with MC2R than the full 1-39 sequence, and that the C-terminus is dispensable for MC2R potency.
Why it matters
Clarifying which residues actually form the MC2R interface has direct implications for the design of minimal ACTH agonists useful in adrenal insufficiency diagnostics and therapeutics, with a smaller synthetic footprint than full ACTH.
Plausibility.70
Novelty.30
Impact.45
Basis · grounding1 paper · 2 computed/notes
[1]
structureboltz-2 ipTM=0.592 for ACTH(1-39) is noticeably lower than ipTM=0.898 for Acetyl-ACTH(1-17) (pep-10667) and 0.773 for ACTH(1-31) (pep-10668), consistent with the tail degrading the global score
[2]
sequenceResidues 25-39 of SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF (NGAEDELAEAFPLEF) are acidic and hydrophobic but lack the basic/aromatic character of the MC2R-binding 1-17 core
[3]
paper
Fridmanis review establishes that MC2R requires only the ACTH N-terminal region for full activation; C-terminal extension is not described as contributing to receptor binding
doi: 10.3389/fendo.2017.00013
openupdated 2026-06-05

Does ACTH suppress appetite in the brain by activating the MC4 receptor, the same receptor targeted by obesity drugs?

If ACTH acts directly on MC4R to reduce hunger, it would explain why severe stress often kills appetite, and could point scientists toward new obesity treatments that mimic this effect without triggering a full stress response. That would matter for millions of people struggling with overeating driven by emotional or metabolic factors.

The hypothesis
Full-length ACTH(1-39) activates MC4R in the hypothalamus with potency comparable to alpha-MSH, meaning endogenous ACTH surges during stress directly suppress appetite via MC4R in addition to driving cortisol release via MC2R.
Why it’s plausible
ACTH(1-39) contains the HFRWG core (residues 6-10) shared with alpha-MSH, and the 1-17 N-terminal sequence is essentially identical to alpha-MSH except for the Ser-to-Ala substitution at position 3 in the database entry. Published data confirm ACTH acts at MC4R with similar potency to alpha-MSH. Stress-induced ACTH surges in the brain could thus directly reduce food intake via MC4R, linking the HPA axis to appetite suppression independently of cortisol.
Why it matters
If stress-ACTH suppresses appetite through MC4R, this provides a mechanistic basis for stress anorexia observed clinically and suggests ACTH-fragment-based MC4R agonists as an underexplored approach to obesity treatment distinct from existing melanocortin drugs.
Plausibility.55
Novelty.35
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
Review states ACTH acts at MC4R with similar potency to alpha-MSH, suggesting direct hypothalamic appetite suppression
doi: 10.1152/physrev.00024.2017
[2]
sequenceACTH(1-39) contains HFRWG at positions 6-10, the pharmacophore shared with alpha-MSH; residues 1-13 overlap with the alpha-MSH sequence
[3]
paper
Melanocortin system at MC4R is a well-established appetite regulator; AGRP is its endogenous antagonist, consistent with ACTH agonism having appetite-suppressing consequences
doi: 10.1016/j.molmet.2021.101206
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.592019259929657 boltz-2
ranking score 0.7194406390190125 boltz-2
structural qualityopenfold3
metricvaluenote
gpde1.275global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Leu-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). ACTH: the brain's stress-hormone trigger (full 39-amino-acid form) (pep-10669, v1). PeptideModel. https://peptidemodel.com/card/pep-10669
@peptide{pep10669,
  sequence = {SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF},
  target   = {mc2r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {synthesized}
}
related peptides 5 by signal overlap
clinical trials 128 on ct.gov · 2 on EUCTR · checked 2026-05-22
ct.gov trials 128
with results 43
EUCTR 2
by phase
2phase 14phase 22phase 34no phase
by status
8completed2unknown
references 8 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use