pe
pep-10656 v1 CC-BY-SA-4.0

TIP39: brain peptide that switches on the PTH1 receptor

A natural brain-signaling peptide that strongly activates the parathyroid hormone 1 receptor (PTH1R), a target involved in bone and calcium signaling; used only as a lab research tool.

statuscomputed targetPTH1R length39 aa refs1
status 2 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.795
pTM0.624
avg pLDDT42.3
ranking score0.928
STRUCTURE · PEP-10656 × PTH1R
ranking0.928
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence39 aa
1510152025303539
SLALADDAAFRER ARLLAALERRHWL NSYMHKLLVLDAP
in the news 1 article
overview readme

Snapshot

Class: Endogenous neuropeptide; PTH2 receptor agonist
Evidence tier: In vitro / assay evidence
Status: No approved therapeutic status identified
Best-supported effect: Potent and selective activation of the PTH2 receptor in cell-based assays — EC50 ≈ 0.5 nM at human PTH2R and ≈ 0.8 nM at rat PTH2R; substantially more potent than parathyroid hormone at the rat receptor in the same assay system
Main caveat: Evidence is limited to in vitro receptor activation assays from a single 1999 publication; no animal efficacy data or human data are present


What this is

TIP-39 (Tuberoinfundibular Peptide of 39 residues) is an endogenous 39-amino acid peptide originally isolated from bovine hypothalamus. It was identified as a potent and selective agonist at the parathyroid hormone 2 receptor (PTH2R), a G protein-coupled receptor expressed in pituitary regions relevant to hormone secretion and in spinal cord areas associated with pain processing. In cell-based assays using synthetic TIP-39, the peptide was substantially more potent than parathyroid hormone (PTH) at the rat PTH2R. Proposed biological roles in hormone secretion and pain signaling are mechanistic hypotheses based on receptor expression patterns; functional in vivo roles are not characterized.


Evidence map

Evidence layerGradeWhat it supports
HumanNone identifiedNo human trial, observational, or case-report data are identifieds available literature
AnimalNone identifiedNo animal efficacy data are individually extracted from the available literature
In vitroWeakPTH2R agonist activity confirmed in human and rat receptor-activation assays; sub-nanomolar EC50 values reported in a single peer-reviewed publication (Usdin et al., 1999); no independent replication data present in available literature
ComputationalNone identifiedNo structure prediction or docking data are attached
MechanismPlausiblePTH2R agonism supported by functional in vitro assay data; downstream pathway characterization and in vivo mechanism are not individually extracted from the available literature

Claim check

ClaimVerdictEvidence layerConfidence
Activates the human PTH2 receptor in vitroSupported (in vitro)In vitro assayHigh — single primary paper; assay format details not fully described in source
More potent than PTH at the rat PTH2 receptor in cell-based assaysSupported (in vitro)In vitro assayHigh — same single-study limitation applies
Modulates pituitary hormone secretion or spinal pain signaling in vivoNot establishedIn vitro (receptor expression context only)Low
Therapeutic utility in any clinical indicationNot establishedNoneLow

Assay conditions

This section reports concentrations used in in vitro assays. It does not establish animal or human exposure.

ContextSystemAssay conditionTimepointEndpointLimitation
Receptor activation assayHuman PTH2 receptor (expressed system)Synthetic TIP-39; concentration seriesNot individually extractedEC50 ≈ 0.5 ± 0.12 nMSingle publication; assay format and cell-line details not described in available literature; no in vivo or human translation established
Receptor activation assayRat PTH2 receptor (expressed system)Synthetic TIP-39; concentration seriesNot individually extractedEC50 ≈ 0.8 ± 0.3 nMSingle publication; same limitations apply
Comparative assay (reference)Rat PTH2 receptor (expressed system)Parathyroid hormone (PTH); concentration seriesNot individually extractedEC50 ≈ 49 ± 23 nM (PTH reference)Comparator datum only; no in vivo comparison established

Assay limitations

  • All quantitative evidence derives from receptor-activation assays in one publication. No independent replication data are present.
  • Assay system details — including cell line, receptor expression system, and assay readout (e.g., cAMP, HTRF, or other) — are not individually described in the available literature.
  • In vitro EC50 values characterize receptor agonism in an artificial system; they do not establish in vivo potency, bioavailability, pharmacokinetics, CNS penetration, or therapeutic efficacy.
  • Proposed roles in pituitary hormone secretion and spinal pain signaling derive from receptor distribution context, not from functional or behavioral endpoint data.
  • No animal toxicology, pharmacokinetic, or safety data are present in the available literature.
  • No human data of any kind are present in the available literature.

Mechanism

TIP-39 acts as an agonist at the parathyroid hormone 2 receptor (PTH2R), a class B G protein-coupled receptor. In functional cell-based assays, synthetic TIP-39 activated both human and rat PTH2R at sub-nanomolar concentrations — approximately 60-fold more potent than PTH at the rat receptor in the same system. PTH2R is expressed in pituitary regions associated with hormone secretion and in spinal cord areas linked to pain processing, which forms the basis for proposals that TIP-39 may participate in neuroendocrine and pain-related signaling. These proposed roles are mechanistic hypotheses extrapolated from receptor expression and in vitro activity; no in vivo characterization of downstream effects is present.


Chemistry

FieldValue
Amino-acid sequence (one-letter)SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Amino-acid chain (three-letter)H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro
Length39 amino acids
TopologyLinear
N-terminusFree amine (H–)
C-terminusFree acid (–OH)
ModificationsNone reported in available literature
OriginOriginally isolated from bovine hypothalamus; assay data used synthetic form
Molecular weightNot provided in available literature
FormulaNot provided in available literature
CASNot provided in available literature
Sequence confidenceNeeds review — sequence derives from a single vendor catalog entry citing Usdin et al. (1999); cross-verification against primary sequence databases not performed in this card's authoring pass

Open questions

  • Animal translation: No animal efficacy data are present.
  • Selectivity profile: Selectivity for PTH2R over PTH1R and other related receptors is not fully characterized in the available literature beyond the reported EC50 comparison with PTH.
  • Endogenous physiological role: The role of endogenous TIP-39 in human or rodent neuroendocrine and pain systems is not resolved from the available literature.
  • Pharmacokinetics and stability: No data on half-life, metabolic stability, blood-brain barrier penetration, or systemic pharmacokinetics are present in the available literature.
  • Downstream signaling: The intracellular signaling cascade downstream of PTH2R activation by TIP-39 — including G protein coupling, second messenger effectors, and system-level outcomes — is not characterized in the available literature.
  • Sequence verification: The sequence is reported from a single vendor catalog entry; cross-verification against the primary 1999 literature and sequence databases has not been performed in this authoring pass.
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does the back half of TIP-39 act as the molecular key that unlocks PTH2R but not PTH1R?

If true, scientists could redesign just that tail region to make highly targeted drugs for pain or hormone disorders, while avoiding unwanted effects on bones or kidneys that come from activating the related receptor.

The hypothesis
TIP-39 binds PTH2R with high affinity through a bipartite mechanism in which its N-terminal helix (residues 1-14, SLALADDAAFRERA) anchors receptor activation while its C-terminal amphipathic region (residues 15-39, RLLAALERRHWLNSYMHKLLVLDAP) determines receptor selectivity over PTH1R.
Why it’s plausible
The sequence contains two structurally distinct segments: an alanine-rich N-terminal region with a pattern consistent with an alpha-helix (SLALADDAAFRERA) and a C-terminal region carrying aromatic and cationic residues (W28, H32, R20, R21) that could form a hydrophobic face. This bipartite architecture mirrors the established 'two-domain' binding model for PTH at PTH1R, where the N-terminus drives receptor activation and the C-terminus drives affinity and selectivity. The strong preference of TIP-39 for PTH2R over PTH1R (>100-fold selectivity in assays) despite sharing the same general scaffold as PTH suggests the C-terminal divergences encode receptor discrimination. The ipTM of 0.795 with PTH1R indicates a plausible but suboptimal engagement, consistent with the annotated selectivity mismatch between the target annotation (PTH1R) and the pharmacological profile (PTH2R agonist).
Why it matters
If confirmed, this would identify specific residue positions that encode PTH2R selectivity, providing a rational blueprint for engineering selective PTH2R agonists or antagonists for pain and neuroendocrine indications without activating PTH1R-mediated bone and kidney pathways.
Plausibility.75
Novelty.50
Impact.70
Basis · grounding1 paper · 3 computed/notes
[1]
sequenceResidues 1-14 (SLALADDAAFRERA) are alanine-rich and predicted to form an amphipathic helix; residues 20-21 (RR), 28 (W), 32 (H) form a cationic/aromatic cluster in the C-terminal half.
[2]
structureipTM=0.795 with PTH1R suggests moderate but imperfect structural complementarity, consistent with the pharmacological selectivity for PTH2R over PTH1R.
[3]
noteEC50 approximately 0.5 nM at human PTH2R; substantially more potent than PTH at rat PTH2R in the same assay, implying a distinct receptor-contact mode.
[4]
paper
PTH family receptor biology framework establishing two-domain binding model for PTH/PTH1R, applicable by analogy to TIP-39/PTH2R.
doi: 10.1124/pr.114.009464
openupdated 2026-06-05

Could chemically locking TIP-39 into its receptor-binding shape make it more stable and potent as a drug?

Most natural peptides break down too fast to be useful medicines. If pre-shaping TIP-39 extends its lifetime in the body, it could become a viable drug for pain or stress disorders that would otherwise be impossible to develop.

The hypothesis
The pLDDT of 42.3 in the structure prediction reflects genuine intrinsic disorder in TIP-39's free-solution conformation, predicting that receptor-bound TIP-39 undergoes a disorder-to-order transition, and that stapled or cyclized analogs that pre-organize the helical segment (residues 1-20) will show enhanced PTH2R potency and in vivo half-life.
Why it’s plausible
A pLDDT of 42.3 is squarely in the disordered range (below 50), consistent with a natively disordered peptide in solution. TIP-39's sequence includes an alanine-rich N-terminal stretch (SLALADDAAFRERA) that is classically helix-prone but may require the receptor surface to nucleate and stabilize helix formation. This is a recognized feature of many GPCR-targeting peptides, where pre-organization through stapling or alpha-methylation increases both affinity and protease resistance. The C-terminal region (RLLAALERRHWLNSYMHKLLVLDAP) also contains an LL repeat (L15, L16) and a second KLLV motif (H32, K33, L34, L35) suggestive of a second nascent helix. Engineering a bicyclic or stapled version pre-organizing both helices could dramatically improve metabolic stability without sacrificing receptor contacts.
Why it matters
Stabilized TIP-39 analogs with improved half-life would be required for any therapeutic application, as native neuropeptides are rapidly degraded in plasma and CSF. This hypothesis provides a structure-based rationale for the specific engineering strategy most likely to succeed.
Plausibility.75
Novelty.45
Impact.65
Basis · grounding1 paper · 3 computed/notes
[1]
structurepLDDT=42.3 is in the intrinsically disordered range, indicating TIP-39 lacks a stable free-solution fold and likely adopts helical structure only upon receptor engagement.
[2]
sequenceResidues 1-14 (SLALADDAAFRERA) have high alanine content (A3, A4, A8, A9, A12, A13) consistent with a helix-forming propensity that may require the membrane-proximal receptor environment to fully organize.
[3]
sequenceL15-L16 and K33-L34-L35-V36 form two leucine-rich clusters separated by a flexible mid-peptide stretch (R20-H32), suggesting a two-helix topology with a hinge.
[4]
paper
PTH family peptide analogs including stapled PTH-related peptides are discussed in the receptor pharmacology context, establishing precedent for helix-stabilization strategies in this peptide class.
doi: 10.1124/pr.114.009464
openupdated 2026-06-05

Could TIP-39 act on the pituitary to turn down the body's overactive stress response?

If true, this could open a new drug target for PTSD and depression that works differently from all current treatments, potentially helping patients who do not respond to existing medications.

The hypothesis
TIP-39 or a stabilized analog could suppress pathological stress-axis hyperactivation by acting on pituitary PTH2R to inhibit CRH-driven ACTH release, positioning PTH2R as a tractable neuroendocrine target for stress-related disorders such as PTSD or major depressive disorder.
Why it’s plausible
PTH2R is expressed in pituitary regions relevant to hormone secretion, noted in the README. The hypothalamic-pituitary-adrenal (HPA) axis is the central stress-response system, and its chronic overactivation underlies PTSD and MDD. TIP-39 is an endogenous hypothalamic peptide; hypothalamic peptides frequently regulate their downstream pituitary targets. PTH2R in the pituitary could sit at a regulatory node modulating corticotroph (ACTH-secreting cell) sensitivity to CRH. Gs-cAMP signaling in corticotrophs is complex: depending on timing and receptor crosstalk, PTH2R activation could compete with or potentiate CRH receptor signaling. The nanomolar potency of TIP-39 and its endogenous hypothalamic origin make this a physiologically plausible regulatory axis.
Why it matters
PTH2R-targeted neuroendocrine modulation would offer a mechanistically distinct entry point into HPA axis pharmacology, complementing existing approaches (CRH1R antagonists, glucocorticoid receptor modulators) that have faced clinical translation challenges.
Plausibility.60
Novelty.55
Impact.70
Basis · grounding1 paper · 2 computed/notes
[1]
notePTH2R is expressed in pituitary regions relevant to hormone secretion; TIP-39 is an endogenous hypothalamic neuropeptide, directly implicating a hypothalamus-to-pituitary signaling role.
[2]
noteProposed biological roles in hormone secretion are noted as mechanistic hypotheses based on receptor distribution, leaving the claim testable but not yet verified.
[3]
paper
Provides the receptor pharmacology context for PTH family GPCRs including their Gs coupling and pituitary relevance.
doi: 10.1124/pr.114.009464
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.7950819134712219 openfold3-mlx
ranking score 0.9278737306594849 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.924global PDE — lower = better
disorder0.334! high disorder
chain pair ipTM (A, B)0.795interface quality
3-letter notation
Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weightsaedd8f3eb814e392…
hardwareapple_m4_base_16gb
mlx version0.31.1
python3.14.3
random seed42
msa strategycolabfold
diffusion samples1
runtime765s
predicted bymlx@peptide
predicted at2026-04-24
python3 openfold3/run_openfold.py predict --query_json {query.json} --runner_yaml examples/example_runner_yamls/mlx_runner.yml --output_dir {output_dir} --num_diffusion_samples 1
citationbibtex
peptidemodel (2026). TIP39: brain peptide that switches on the PTH1 receptor (pep-10656, v1). PeptideModel. https://peptidemodel.com/card/pep-10656
@peptide{pep10656,
  sequence = {SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP},
  target   = {pth1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 3 by signal overlap
clinical trials 0 trials · checked 2026-05-09
0
no registered clinical trials as of 2026-05-09; we'll re-check periodically
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use