Bone-receptor research tool (pTH 3-34, bovine)
A lab-made fragment of cow parathyroid hormone that blocks the bone-regulating receptor without triggering its signal, used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
Named peptide fragment — synthesized for research; ClinicalTrials.gov trials registered for parent compound or class
Fork this card to add platform evidence →
Endogenous peptide fragment — receptor binding/activity established in published literature; CT.gov evidence
Fork this card to add platform evidence →
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could adding a molecular crosslink to this peptide stop it from being broken down before it reaches bone cells?
If so, this could lead to an injectable drug candidate that precisely dials down the bone-hormone receptor, helping patients whose PTH signaling is overactive, such as those with parathyroid tumors or chronic kidney disease.
Could blocking the bone-hormone receptor specifically in the kidney help prevent the phosphate imbalance that damages hearts in kidney disease?
If true, this approach could protect heart and blood-vessel health in the millions of people living with chronic kidney disease, without disrupting the bone-building effects they may still need.
Do the small differences between bovine and human PTH fragments change which of the two PTH receptors this peptide prefers?
Identifying such a difference would give scientists a cleaner tool to study the second PTH receptor, which is poorly understood but may play roles in brain and reproductive health.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.918671727180481 | boltz-2 |
| ranking score | 0.6693214774131775 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | colabfold_local |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-22 |
▸citationbibtex
@peptide{pep10652,
sequence = {SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF},
target = {pth1r},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}