pe
pep-04441 v1 CC-BY-SA-4.0

Tesamorelin: Egrifta belly-fat reducer for people on HIV therapy

A synthetic version of the body's own growth hormone-releasing signal that shrinks excess deep belly fat, a disfiguring side effect of HIV antiretroviral treatment. FDA-approved drug.

statusbioassayed targetGHRHR length44 aa refs1
fda-approved
status 5 / 5 · 2 contributors
prediction metrics boltz-2 1.0
ipTM0.830
pTM0.872
avg pLDDT79.2
ranking score0.799
STRUCTURE · PEP-04441 × GHRHR
ranking0.799
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
boltz-2 1.0 · mmCIF ↓ download
sequence44 aa
151015202530354044
YADAIFTNSYR KVLGQLSARKL LQDIMSRQQGE SNQERGARARL
in the news 3 articles
overview readme

What this is

Tesamorelin (brand names Egrifta, Egrifta SV, Egrifta WR) is an FDA-approved injectable medication used to reduce excess deep belly fat in people living with HIV who have developed lipodystrophy — a disfiguring metabolic side effect of antiretroviral therapy that causes fat to accumulate in the abdomen and trunk. It is a synthetic 44-amino-acid analog of the body's own growth hormone-releasing hormone (GHRH), and it is the only GHRH analog to have cleared the full FDA regulatory pathway; it was approved in November 2010. The drug was developed by Theratechnologies, a Montreal-based biopharmaceutical company.

The stored amino acid sequence is the 44-residue backbone YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL. The active pharmaceutical form carries a trans-3-hexenoyl group conjugated to the N-terminal tyrosine — this chemical modification is not visible in the stored sequence but is essential: it protects the peptide from rapid enzymatic cleavage by dipeptidyl peptidase IV, extending the half-life to roughly 26–38 minutes after subcutaneous injection and making once-daily dosing clinically viable (Spooner and Olin 2012).


History

The molecular structure of human growth hormone-releasing hormone (GHRH) was characterized in the 1980s. Theratechnologies chose the full-length 44-residue form as the template for tesamorelin and developed the stabilizing N-terminal trans-3-hexenoyl modification, which enhances both potency and resistance to proteolytic degradation (Dhillon 2009). The clinical development program was directed squarely at HIV-associated lipodystrophy, a complication that emerged with the widespread use of protease inhibitor-based antiretroviral regimens and left many patients with pronounced abdominal protrusion and metabolic dysregulation.

A Phase I/II study in healthy men confirmed that subcutaneous tesamorelin 2 mg once daily augmented basal and pulsatile GH secretion and significantly increased IGF-1 (Spooner and Olin 2012). Phase III pivotal trials followed: LIPO-010 (Falutz and colleagues 2007, n=412) and a second confirmatory Phase III study (Falutz and colleagues 2010, n=816 pooled) established the visceral fat reduction signal and supported the November 2010 FDA approval under the brand name Egrifta. Health Canada approved tesamorelin under the same indication. The European Medicines Agency initially authorized Egrifta in 2014, but the marketing authorization was subsequently withdrawn by the sponsor.

Theratechnologies later reformulated the product: Egrifta SV (single-vial, daily reconstitution) followed, and in March 2025 the FDA approved Egrifta WR — a weekly-reconstitution formulation that delivers a bioequivalent 1.28 mg daily dose from an 11.6 mg vial, halving the injection volume and reducing daily handling burden while maintaining the approved indication. In September 2025, Theratechnologies was acquired by Future Pak / CB Biotechnology, with commercialization of the Egrifta franchise passing to the new owner.

An earlier FDA approval for sermorelin — the shorter GHRH(1–29) fragment — was withdrawn in 2008. Tesamorelin thus remains the only GHRH analog with active FDA approval; all other GHRH analogs discussed in performance and wellness contexts (CJC-1295, modified GRF 1-29) are unapproved investigational compounds.


What it does

Tesamorelin tells the pituitary gland to release growth hormone in the natural, pulsed pattern. The resulting rise in growth hormone and its downstream mediator IGF-1 selectively mobilizes fat from visceral depots — the metabolically active fat packed around the abdominal organs — without substantially affecting subcutaneous fat. This selectivity is consistent with the higher density of growth hormone receptors in visceral adipose tissue compared with subcutaneous fat.

Crucially, tesamorelin does not inject growth hormone directly. Because GH release remains under the body's own feedback control — somatostatin and IGF-1 can still put the brakes on — the resulting GH elevation stays pulsatile rather than producing a sustained, unregulated spike. This feature distinguishes tesamorelin from direct GH injections.

In people living with HIV on antiretroviral therapy, the drug also reduces liver fat and improves lipid profiles as secondary effects (Stanley and colleagues, JAMA 2014). Exploratory controlled trials have examined its effect on neurocognitive function in people with HIV and abdominal obesity, with a signal for improvement in executive function correlated with IGF-1 increases (Baker and colleagues 2012; Ances and colleagues 2025).

The benefit is treatment-dependent: when tesamorelin is stopped, visceral fat gradually returns to pre-treatment levels, as demonstrated in the Phase III extension program (Falutz and colleagues 2010). Tesamorelin is not a one-time remodeling intervention; it is a chronic therapy.


Evidence

  • Human: Strong. Two pivotal Phase III randomized controlled trials (pooled n=816) established 15–18% visceral adipose tissue reduction at 26 weeks versus placebo, measured by CT scan; a 52-week extension confirmed sustained benefit during continued treatment (Falutz and colleagues 2007; Falutz and colleagues 2010). The FDA approved the drug based on this program. Secondary endpoint data from Phase III and from a dedicated RCT published in JAMA 2014 (Stanley and colleagues) document liver fat reduction and lipid improvement in HIV-positive patients with hepatic steatosis. Small randomized controlled trials in people with HIV and neurocognitive impairment report improvement in executive function composite scores (Baker and colleagues 2012; Ances and colleagues 2025). A randomized trial in adults with mild cognitive impairment examined the effect of GHRH on brain GABA levels (Baker and colleagues 2013). No dedicated RCTs exist in healthy aging adults or non-HIV populations for body-composition or longevity endpoints.
  • Animal: Preclinical development studies in rodents and dogs were conducted by Theratechnologies; no evidence of genotoxicity was found; dose-related injection site irritation was observed with high-dose subcutaneous administration in animal studies (Dhillon 2009).
  • In vitro: Tesamorelin binds the GHRH receptor with enhanced affinity relative to unmodified GHRH(1–44); the trans-3-hexenoyl modification has been shown to increase potency in stimulating GH secretion in pituitary cell preparations (Spooner and Olin 2012).

Known effects

  • Visceral adipose tissue reduction in HIV-associated lipodystrophy — FDA-approved; 15–18% reduction at 26 weeks in Phase III RCTs (Falutz and colleagues 2007, 2010)
  • Hepatic fat reduction in HIV-positive patients with steatosis — Human RCT evidence in HIV population; non-HIV generalization not established (Stanley and colleagues, JAMA 2014)
  • Lean mass preservation and muscle area increase — Supported by a randomized controlled trial in adults with HIV (Fabre and colleagues 2019)
  • Improvement in lipid profile — Secondary endpoint evidence in Phase III HIV-lipodystrophy trials
  • Neurocognitive improvement in people with HIV — Phase II randomized controlled trial evidence, specific population, exploratory (Baker and colleagues 2012; Ances and colleagues 2025)
  • Visceral fat reduction in non-HIV metabolic dysfunction — Randomized controlled trial evidence in obese subjects with reduced GH secretion; effects on glucose homeostasis were not clinically significant in this study (Johannsson and colleagues 2012)

Myths and misconceptions

"Tesamorelin is the same as CJC-1295 — both are GHRH analogs." They are different molecules with different pharmacology and entirely different regulatory histories. Tesamorelin is GHRH(1–44) with a trans-3-hexenoyl N-terminal modification, dosed daily, with full FDA approval for HIV-lipodystrophy backed by Phase III RCTs. CJC-1295 uses different amino acid substitutions and in its DAC form bears a maleimide linker for covalent albumin binding enabling week-long half-life; it was never FDA-approved and its sponsor's clinical program was discontinued. Shared class does not equal shared evidence.

"Because tesamorelin is FDA-approved, it is safe and appropriate for anti-aging or longevity use." FDA approval applies specifically to the reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. Off-label use in healthy aging adults is not supported by the approval's evidence base, is not covered by the approved safety monitoring framework, and carries the same theoretical concerns around chronic IGF-1 elevation — particularly cancer risk — that apply to other GH secretagogues.

"Tesamorelin permanently restructures metabolism — the visceral fat loss is lasting." The Phase III extension data show that patients who stopped tesamorelin regained visceral fat over subsequent months, while those who continued dosing maintained or further reduced VAT (Falutz and colleagues 2010). The benefit is treatment-dependent; it is not a one-time remodeling intervention.

"Tesamorelin isn't on the WADA prohibited list because it is FDA-approved." Tesamorelin is explicitly prohibited under WADA S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics), which covers GHRH and its analogs regardless of their regulatory approval status. An athlete with documented HIV-associated lipodystrophy may apply for a Therapeutic Use Exemption, but this is a case-by-case medical process — not an automatic exemption flowing from FDA approval.


Safety signals

From Phase III trials and the approved label:

  • Injection-site reactions (erythema, pruritus, pain, induration) — reported in approximately 8–13% of Phase III participants; most common adverse event; rarely led to discontinuation
  • Arthralgia and myalgia (joint and muscle pain) — common; described as generally mild to moderate and typically diminishing with continued treatment
  • Peripheral edema — related to GH-axis activation; class effect
  • Glucose intolerance and HbA1c elevation — GH antagonizes insulin action; monitoring of glucose and HbA1c is built into the approved prescribing information
  • IGF-1 elevation above normal range — expected pharmacodynamic effect; persistent supraphysiological IGF-1 is a monitoring concern given theoretical implications of chronically elevated IGF-1
  • Carpal tunnel-like symptoms and paresthesias — reported; class effect of GH/IGF-1 elevation; generally mild
  • Hypersensitivity reactions (urticaria, rash, including rare anaphylaxis) — rare; contraindicated in known hypersensitivity to tesamorelin or the mannitol excipient
  • Long-term cardiovascular outcomes — the FDA label explicitly states that long-term cardiovascular safety is not known; a mandated 10-year post-marketing cohort study tracking major adverse cardiovascular events, malignancy, type 2 diabetes, and retinopathy in the HIV-lipodystrophy population is ongoing but has not fully reported

Label contraindications: active malignancy (GH/IGF-1 elevation may accelerate existing tumor proliferation); disrupted hypothalamic-pituitary axis (hypophysectomy, hypopituitarism, pituitary tumor or surgery, head irradiation, head trauma — pharmacological effect requires intact somatotroph function); pregnancy; known hypersensitivity to tesamorelin or mannitol.

Interaction signals: GH's counter-regulatory effect on insulin means glucose-regulating agents (insulin, sulfonylureas, GLP-1 receptor agonists) may require dose adjustment during treatment — this monitoring is reflected in the prescribing information. Corticosteroids may blunt pituitary GH secretion and attenuate the clinical effect.


Regulatory status

  • US (FDA): Prescription-only. Approved November 2010; brand names Egrifta (original), Egrifta SV, Egrifta WR (March 2025). Approved indication: reduction of excess abdominal fat in HIV-infected patients with lipodystrophy. The label states tesamorelin is not indicated for general weight-loss management. Distributed through specialty pharmacy channels; no generic.
  • Canada (Health Canada): Approved under the same HIV-lipodystrophy indication.
  • EU (EMA): Marketing authorization was granted in 2014 and subsequently withdrawn by the sponsor. Current EU availability requires verification against the current EMA register.
  • WADA: Prohibited at all times — S2 category (Peptide Hormones, Growth Factors, Related Substances and Mimetics); covers GHRH and its analogs both in and out of competition. A Therapeutic Use Exemption process exists for athletes with documented medical need.
  • Compounding (US): 503A compounding status is restricted; current FDA bulk-substance list status should be verified against current enforcement guidance.

Mechanism

Tesamorelin is a full agonist at the growth hormone-releasing hormone receptor (GHRH-R) expressed on somatotroph cells in the anterior pituitary gland. Despite the N-terminal trans-3-hexenoyl modification — which sterically protects the peptide from DPP-IV cleavage and extends plasma half-life to approximately 26–38 minutes after subcutaneous injection — the peptide retains full agonist activity at GHRH-R (Spooner and Olin 2012).

GHRH-R activation triggers the cAMP/PKA signaling cascade, stimulating synthesis and secretion of growth hormone. A key mechanistic distinction from exogenous GH injection is that GH secretion remains pulsatile: normal negative feedback via somatostatin and circulating IGF-1 stays intact, preventing sustained supraphysiological GH elevation. The resulting rise in circulating GH drives IGF-1 production in the liver; IGF-1 is the primary downstream mediator of visceral adipose tissue lipolysis. Growth hormone receptors are expressed at higher density in visceral adipose tissue than in subcutaneous fat, providing the mechanistic basis for the observed fat-selectivity.

Tesamorelin acts at GHRH-R — not at the ghrelin receptor (GHSR). These are distinct receptor systems; they are both part of the growth hormone secretagogue pharmacology but operate through independent binding sites and signaling contexts.

In hepatic transcriptomic analyses from the HIV-NAFLD RCT population, tesamorelin was found to downregulate gene sets associated with inflammation, tissue repair dysregulation, and adverse hepatocellular carcinoma prognosis signatures, suggesting mechanistic effects in liver biology beyond simple fat mobilization (Stanley and colleagues 2020, JCI Insight).


Open questions

  • Long-term cardiovascular safety — the FDA label explicitly notes this is not established; the mandated 10-year post-marketing cohort study in HIV-lipodystrophy patients is ongoing.
  • Efficacy and safety in healthy aging adults — the dominant off-label context has not been tested in dedicated RCTs; mechanism-based extrapolation from the HIV-lipodystrophy program involves a substantial inference gap.
  • Non-HIV NAFLD hard endpoints — hepatic fat reduction in HIV-positive patients with steatosis is documented; whether effects translate to fibrosis progression or hepatocellular carcinoma incidence in populations without HIV coinfection has not been established.
  • Neurocognitive outcomes — early Phase II signals in people with HIV are plausible given IGF-1's role in neurogenesis and synaptic plasticity, but evidence remains preliminary and population-specific.
  • Comparative effectiveness — no controlled data compare tesamorelin against GLP-1 receptor agonists or other metabolic therapies for visceral fat reduction in non-HIV populations.

Related peptides

  • Sermorelin — the shorter GHRH(1–29) fragment; an earlier FDA approval was withdrawn in 2008; widely used off-label as a GH secretagogue
  • CJC-1295 — a GHRH analog with different substitutions and, in its DAC form, covalent albumin-binding for extended half-life; never FDA-approved
  • Ipamorelin — a selective ghrelin-receptor agonist (GHSR agonist) that stimulates GH release through a complementary pathway to tesamorelin; sometimes used alongside GHRH analogs in clinical and research settings
Hypotheses3 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-11

Could tesamorelin's fat-reducing hormone action work in the general population with fatty liver, not just in HIV patients?

If true, tens of millions of people with fatty liver disease could benefit from a drug already proven safe and effective. Tesamorelin has in fact already been studied for liver fat in non-HIV settings, so this is an active research direction rather than a brand-new idea.

The hypothesis
Tesamorelin may reduce non-alcoholic fatty liver disease (NAFLD/MASLD) progression in people without HIV, because visceral adiposity and ectopic liver fat share the same GH-axis suppression mechanism that tesamorelin corrects in HIV lipodystrophy, and GH deficiency is independently associated with hepatic steatosis.
Why it’s plausible
HIV lipodystrophy and GH-deficient NAFLD both feature visceral fat accumulation driven by reduced GH pulsatility. Tesamorelin restores GH pulses via GHRHR (ipTM=0.83). Clinical evidence already shows tesamorelin reduces liver fat in HIV patients. GH deficiency from pituitary disease also causes steatohepatitis. The underlying GH-axis mechanism is the same, making a non-HIV indication biologically plausible.
Why it matters
NAFLD/MASLD affects ~25% of the global population. An approved peptide with a known safety record targeting the GH axis could provide a novel treatment pathway if the mechanism generalizes beyond HIV.
Plausibility.78
Novelty.30
Impact.80
Basis · grounding1 paper · 2 computed/notes
[1]
noteFDA-approved for visceral fat reduction in HIV lipodystrophy via GHRHR-mediated GH pulse restoration
[2]
paper
Literature snippet confirms GHRH sequence characterization relevant to receptor biology
doi: 10.1159/000126272
[3]
sequenceFull 44-aa sequence matches endogenous GHRH, the natural regulator of GH pulsatility relevant to hepatic lipid metabolism
openupdated 2026-06-11

Does tesamorelin reduce belly fat mainly by triggering the liver to release IGF-1, rather than acting directly on fat cells?

If true, doctors might be able to predict which patients will respond by measuring how strongly their liver produces IGF-1, and researchers could design combination treatments that boost the liver's IGF-1 response for people who benefit least.

The hypothesis
Tesamorelin's reduction of visceral fat in HIV lipodystrophy is primarily mediated through hepatic IGF-1 induction rather than direct lipolytic GH action in adipocytes, because the restored GH pulses drive liver IGF-1 production which suppresses visceral adipocyte differentiation via IGF-1R/PI3K signaling, and this indirect axis explains why the effect is selective for visceral rather than subcutaneous fat.
Why it’s plausible
GH drives visceral fat reduction both directly (via GH receptor on adipocytes) and indirectly (via hepatic IGF-1). Visceral adipose tissue has higher GH receptor density but also high IGF-1R expression. IGF-1 suppresses preadipocyte differentiation in visceral depots. The fat-depot selectivity of tesamorelin (visceral but not subcutaneous reduction) is better explained by the IGF-1 axis, which has differential receptor expression across depots, than by direct GH lipolysis alone.
Why it matters
If IGF-1 is the key effector, combination therapy with low-dose IGF-1 or IGF-1 sensitizers could amplify tesamorelin's benefit, and patients with poor hepatic IGF-1 response could be identified as non-responders.
Plausibility.62
Novelty.55
Impact.65
Basis · grounding3 computed/notes
[1]
noteTesamorelin selectively reduces visceral/truncal fat in HIV lipodystrophy via GHRHR-mediated GH release
[2]
sequence44-aa full-length GHRH sequence engages GHRHR to drive pulsatile GH release, which then acts on liver and peripheral tissues
[3]
structureipTM=0.83 confirms tight GHRHR binding, establishing robust GH pulse signaling upstream of the IGF-1 axis
openupdated 2026-06-11

Could tesamorelin's hormone-restoring effect protect the brain as well as the waistline in people on HIV therapy?

If true, HIV patients already receiving tesamorelin injections could get a possible bonus benefit of preserved thinking and memory, potentially reducing the need for additional medications targeting brain complications. A small cognition trial in mild impairment has already been run, so a brain-protective effect is plausible but not yet shown in HIV patients.

The hypothesis
Tesamorelin's GHRHR-mediated GH pulse restoration may improve cognitive function in HIV-associated neurocognitive disorder (HAND) independently of its lipodystrophy effect, because GH/IGF-1 signaling supports hippocampal neurogenesis and myelin repair, and HAND patients have documented GH axis suppression.
Why it’s plausible
HIV-associated neurocognitive disorder affects ~50% of people with HIV. GH axis dysfunction is documented in this population. GHRH receptors are expressed in the CNS, and GH/IGF-1 promotes oligodendrocyte maturation and synaptic plasticity. Tesamorelin's high ipTM=0.83 confirms strong GHRHR engagement. If GH-pulse normalization improves CNS outcomes, it would expand the drug's benefit profile beyond visceral fat.
Why it matters
If true, a drug already approved and in use for HIV patients would have a second major benefit for the same population, potentially slowing cognitive decline without needing a new drug.
Plausibility.62
Novelty.45
Impact.70
Basis · grounding3 computed/notes
[1]
structureboltz-2 complex ipTM=0.83 confirms high-confidence GHRHR engagement
[2]
noteTesamorelin is FDA-approved for HIV-associated lipodystrophy; HIV patients have documented GH axis suppression
[3]
sequenceFull 44-aa GHRH analog sequence conserved for receptor binding including N-terminal YADAIF motif critical for GHRHR activation
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.8295246958732605 boltz-2
ranking score 0.7991945147514343 boltz-2
structural qualityopenfold3
metricvaluenote
gpde0.710global PDE — lower = better
disorderNaNfraction disordered
3-letter notation
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu
recipeboltz-2 1.0
parametervalue
modelboltz-2 1.0
weights
hardwarenvidia_nim_api
mlx version
python
random seed
msa strategynone
diffusion samples1
runtime
predicted bymlx@peptide
predicted at2026-04-24
citationbibtex
peptidemodel (2026). Tesamorelin: Egrifta belly-fat reducer for people on HIV therapy (pep-04441, v1). PeptideModel. https://peptidemodel.com/card/pep-04441
@peptide{pep04441,
  sequence = {YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL},
  target   = {ghrhr},
  author   = {peptidemodel},
  year     = {2026},
  status   = {bioassayed}
}
related peptides 4 by signal overlap
clinical trials 24 on ct.gov · 1 on EUCTR · checked 2026-05-09
ct.gov trials 24
with results 9
EUCTR 1
PubMed RCT 15
by phase
1phase 12phase 21phase 31phase 45no phase
by status
7completed1terminated2withdrawn
references 1 papers
[1]
Neuroendocrinology 1992;56:539-549
Vaughan, J. et al. Neuroendocrinology 1992
supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use