Sermorelin: growth hormone-releasing drug (Geref)
A synthetic peptide that tells the pituitary gland to release growth hormone; FDA-approved for diagnosing and treating growth hormone deficiency in children, and widely used off-label for anti-aging.
- Class
- GHRH analog (synthetic GHRH 1-29)
- Status
- Not currently FDA-approved as a commercial product; available in the US through state-licensed compounding pharmacies for off-label use. WADA prohibited at all times (class S2).
- Best-supported effect
- Stimulation of pulsatile endogenous growth hormone release; clinical efficacy demonstrated in pediatric idiopathic growth hormone deficiency (FDA approval-era trials).
- Main caveat
- The pediatric GHD evidence base predates the modern recombinant-GH treatment landscape, and the compounding-era adult off-label uses (anti-aging, sleep, body composition) have not been validated in dedicated controlled adult trials.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
What this is
Sermorelin is a synthetic 29-amino-acid peptide that mimics the natural signal your hypothalamus sends to release growth hormone. It is the N-terminal 1–29 fragment of human growth hormone-releasing hormone (GHRH), and it is the shortest portion of that 44-residue native hormone that retains full biological activity at the GHRH receptor. Among GHRH analogs, sermorelin is unusual in having a formal FDA-approval history: it was developed by EMD Serono and received two approvals as Geref — a diagnostic indication in 1990 (for evaluating pituitary GH reserve) and a therapeutic indication in 1997 (for pediatric idiopathic growth hormone deficiency). EMD Serono voluntarily withdrew Geref from the US market in 2008; the FDA determined in 2013 that the withdrawal was made for commercial, not safety or efficacy, reasons. Sermorelin is now available in the US only through state-licensed compounding pharmacies for off-label adult use.
The raw sequence stored for this card — YADAIFTNSYRKVLGQLSARKLLQDIMSRQ — represents the bare backbone. The active peptide as administered carries a C-terminal amide (-NH₂) that is not visible in the stored one-letter sequence; this modification is typical for peptide therapeutics and helps protect the C-terminus from carboxypeptidase degradation.
History
Sermorelin's origin traces to the early 1980s work of Roger Guillemin's group at the Salk Institute, who characterized the full 44-amino-acid GHRH sequence after it was first isolated from pancreatic tumors in acromegalic patients (Ling and colleagues 1984, published in BBRC). A key finding from that period was that the N-terminal 1–29 fragment retained full biological activity — the basis for developing sermorelin as a shorter, synthesizable therapeutic. EMD Serono (then Serono Laboratories) brought it to market as Geref, securing FDA approval first for diagnostic pituitary testing (1990) and then for therapeutic use in children with idiopathic growth hormone deficiency (1997). The pediatric approval made sermorelin one of the very few GH secretagogues ever to clear the full FDA regulatory bar — a distinction that CJC-1295 and ipamorelin have not achieved.
The Geref brand was voluntarily withdrawn from the US market by Serono in 2008. A competing landscape of recombinant human GH products offered more predictable growth outcomes in the pediatric GHD population that required intact pituitary function for sermorelin to work; this commercial shift, not any adverse-event signal, drove the withdrawal. After Geref's exit, sermorelin persisted in clinical use through compounding pharmacies, which began prescribing it off-label for adult indications — anti-aging, body composition, and sleep quality — that were never part of the original Geref label.
What it does
Sermorelin works by prompting the pituitary gland to release more of its own growth hormone, rather than supplying growth hormone externally. By acting on the GHRH receptor on pituitary cells, it triggers a burst of GH secretion that mimics the body's natural pulsatile pattern. Because the peptide is cleared rapidly from the bloodstream — plasma immunoreactivity falls below 50% of peak within about 33 minutes after subcutaneous injection, with an IV elimination half-life of approximately 6 minutes (Prakash and colleagues 1999) — each dose produces a single discrete GH pulse rather than a sustained elevation. The pituitary's own feedback controls remain operative throughout, so GH release is bounded by the body's normal regulatory architecture.
In children with idiopathic growth hormone deficiency, sermorelin significantly increased height velocity at the approved 30 mcg/kg subcutaneous daily dose, with sustained growth-rate improvement over 12 months of treatment and 74% of treated children showing response within six months (Geref International Study Group, reported in Prakash and colleagues 1999). Off-label use in healthy aging adults has been described in small clinical explorations: a prospective study by Vittone and colleagues examined once-nightly injections in eleven men aged 64–76, assessing GH, IGF-1, skeletal muscle function, and body composition over six weeks, though IGF-1 increases were not significant at the 2- and 6-week time points in that nightly-injection protocol, contrasting with results from twice-daily administration studied separately (Sinha and colleagues 2020). No large-scale, dedicated adult efficacy RCT for sermorelin has been identified in the available literature; adult use rests on a mechanistically sound but evidence-thin base.
Evidence
- Human: Strong for the pediatric indication. Pivotal trials supporting the 1997 NDA 20-443 approval demonstrated efficacy in pediatric idiopathic GHD; the Geref International Study Group trial (n≈110, 12 months) reported boosted growth rates in 74% of children at 30 mcg/kg/day (Prakash and colleagues 1999). Early pharmacology studies in adults established pituitary responsiveness under various neuroendocrine conditions (Gelato and colleagues 1985). A small exploratory clinical trial in healthy young adults examined GRF(1-29)NH₂ effects on short-term memory and neuroendocrine endpoints (available in the provenance index). For adult anti-aging and body-composition endpoints, no dedicated RCT has been identified; the Walker 2006 clinical review in Clinical Interventions in Aging proposed adult use but was not itself a controlled trial.
- Animal: Well-characterized. Receptor activation, GH release, and downstream IGF-1 pharmacology established in rodents, lambs, and goats; DPP-IV degradation kinetics characterized at the intestinal brush-border level; receptor antagonist structure-activity work published in the 1980s–1990s literature.
- In vitro: Receptor pharmacology characterized including adenylate cyclase activation and structural requirements, histamine-release studies in rat mast cells, and NMR secondary structure determination of the GRF(1-29) peptide backbone.
Known effects
- Stimulation of pulsatile endogenous GH release — Supported (human, mechanism); well-characterized across IV and subcutaneous administration routes
- Pediatric growth-rate improvement in idiopathic GHD — FDA-approved (historical Geref label, NDA 20-443); pivotal clinical trials
- Pituitary GH-reserve testing — FDA-approved diagnostic use (historical Geref Diagnostic, NDA 19-863); single-dose IV protocol
- Body composition and lean mass — Emerging/anecdotal in adults; mechanistically plausible via IGF-1 pathway; no controlled adult RCT identified
- Sleep quality — Anecdotal; proposed mechanism is alignment of administration with endogenous nocturnal GH pulse; no controlled adult RCT identified
- Anti-aging endpoints — Anecdotal; review-level support only (Walker 2006); not validated in controlled adult trials
Safety signals
Adverse effects documented in the Geref label-era clinical experience include injection-site reactions, facial flushing, headache, dizziness, and altered sense of taste — generally mild and transient. Histamine release from mast cells elicited by GRF(1-29)NH₂ is documented in preclinical studies, providing a mechanistic basis for some of these effects (provenance index). Untreated hypothyroidism, obesity, hyperglycemia, and elevated plasma fatty acids are associated with subnormal GH responses to sermorelin and are noted in the approval-era safety literature (Prakash and colleagues 1999). Caution in epilepsy was also noted in the original Geref labeling.
The downstream pharmacology — sermorelin raises GH, which raises hepatic IGF-1 — carries the same theoretical long-term concerns (cancer-promotion risk, metabolic effects) associated with sustained IGF-1 elevation from exogenous recombinant GH, even though sermorelin preserves pulsatility and feedback regulation rather than maintaining flat GH elevation. Long-term adult safety data at compounding-era off-label doses are not characterized in the published literature identified.
Label-era contraindications described in the available literature include active or recent-history malignancy, pregnancy (Geref was Pregnancy Category C), breastfeeding (excretion into breast milk not characterized), uncontrolled diabetes or insulin resistance, uncontrolled hypothyroidism, active acromegaly or pituitary adenoma, severe obesity (GH response may be blunted), and hypersensitivity to sermorelin or its excipients (historical Geref used mannitol as an excipient). Drug interactions described in the available literature include glucocorticoids (blunt somatotroph response), somatostatin analogs such as octreotide (directly antagonize GHRH signaling), and thyroid status (uncorrected hypothyroidism reduces GH response). These represent approval-era label and literature findings, not clinical management guidance.
Regulatory status
- US (FDA): No active commercial approval. Geref (NDA 19-863 diagnostic 1990; NDA 20-443 pediatric therapeutic 1997) was voluntarily withdrawn by EMD Serono in 2008; the FDA formally determined in 2013 that the withdrawal was not for reasons of safety or effectiveness. Sermorelin is available through state-licensed compounding pharmacies under individualized prescription for off-label adult use; compounded preparations are not FDA-reviewed, and current FDA 503A bulk-substance review status should be verified.
- EU (EMA) / UK (MHRA): No current approval identified.
- Canada: No current approval identified.
- Australia (TGA): GH secretagogues and GHRH analogs are classified Schedule 4 (prescription-only).
- WADA: Prohibited at all times — class S2 (Peptide Hormones, Growth Factors, Related Substances and Mimetics). Prior FDA approval does not exempt sermorelin from WADA prohibition; LC-MS/MS detection methods exist and athlete sanctions for sermorelin use have been reported (Sinha and colleagues 2020).
Mechanism
Sermorelin binds to the GHRH receptor on anterior-pituitary somatotrophs. Receptor activation engages adenylyl cyclase, raising intracellular cAMP and activating PKA signaling, which promotes both synthesis and pulsatile secretion of growth hormone (Prakash and colleagues 1999). Because the peptide is rapidly cleared — IV elimination half-life approximately 6 minutes, with subcutaneous immunoreactivity falling below 50% of peak within about 33 minutes — each administered dose produces a single transient GH pulse rather than sustained receptor occupancy. The hypothalamic-pituitary feedback loop, particularly somatostatin-mediated negative feedback, remains operative; GH output is therefore bounded by the pituitary's own regulatory architecture. The downstream pharmacology (GH → hepatic IGF-1) is the same axis activated by exogenous recombinant GH; what differs is the upstream stimulus and the preservation of pulsatile GH release pattern. Structure-activity studies established that the N-terminal residues of GHRH (Tyr¹ and the Ala³ region) are critical for adenylate cyclase activation at the rat anterior pituitary, while the 1–29 fragment is the shortest portion retaining full activity of the native 44-residue GHRH (Ling and colleagues 1984; Prakash and colleagues 1999).
Open questions
- Modern adult efficacy data: No dedicated adult-onset GHD or adult anti-aging efficacy RCT for sermorelin is identified in the available literature. Whether the pediatric pharmacology translates to meaningful adult clinical endpoints has not been established in controlled trials.
- Long-term adult safety at off-label exposures: The approval-era safety dataset is pediatric and shorter-term. Long-duration safety in healthy or aging adults using compounding-era regimens is uncharacterized in the available published literature.
- Pulsatility versus matched IGF-1 exposure: Whether preserved pulsatility translates to a meaningfully different long-term safety margin compared with exogenous recombinant GH at matched IGF-1 exposure has not been tested in long-duration comparative endpoint trials.
- Modern head-to-head with rhGH: Controlled comparisons against current-standard recombinant GH in pediatric or adult GHD are limited; the approval-era evidence base predates the modern rhGH-dominant treatment landscape.
- Combination use with GHRPs: Sermorelin combined with a growth-hormone-releasing peptide (e.g., ipamorelin or GHRP-2) has pharmacological rationale — the two classes act through distinct receptors (GHRH receptor vs. GHS-R1a) — but controlled human outcome data for combination use is not identified in the available literature.
- 503A bulk-substance status: The FDA's ongoing 503A review creates continuing uncertainty about long-term compounding-pharmacy access for sermorelin; current status should be verified against updated FDA lists.
Related peptides
- CJC-1295 — modified derivative of the same 1–29 GHRH fragment; carries a D-Ala substitution and a maleimido group enabling covalent albumin binding, extending half-life from minutes to 6–8 days; not FDA-approved; no separate card yet
- Tesamorelin — FDA-approved full-length GHRH analog (trans-3-hexenoyl-GHRH 1-44) approved for HIV-associated lipodystrophy; longer sequence than sermorelin; same GHRH-receptor mechanism, longer duration of action
- Ipamorelin — growth hormone-releasing peptide (GHRP) that acts through the GHS-R1a receptor rather than the GHRH receptor; pharmacologically complementary to sermorelin; not FDA-approved; no separate card yet
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Has sermorelin been linked to the wrong cellular target in research databases, and does fixing that error change what the science actually shows?
If the annotation is corrected, every analysis built on this card, such as structure studies and drug interaction maps, would reflect accurate biology instead of misleading results. Scientists and developers relying on this data would avoid wasted experiments chasing the wrong target.
Could the excess fatty acids circulating in obese adults be physically dampening the receptor that sermorelin needs to activate, rather than the body simply producing too much suppressive hormone?
If fatty acids are the real culprit, there could be a way to restore sermorelin's effectiveness in obese patients, perhaps through diet, omega-3 supplements, or existing lipid-lowering drugs, without simply raising the dose. That would matter for the many adults who use sermorelin off-label to treat growth hormone deficiency tied to obesity.
Would changing just one amino acid in sermorelin's chain stop the enzyme that destroys it quickly, extending how long the drug stays active without changing how it works?
If confirmed, this small chemical tweak could turn sermorelin from a drug that disappears within minutes into one that works for much longer per injection. For the adults who use it daily, that could mean fewer injections and more consistent results, while keeping the same safe, regulated way it signals the body.
Could attaching a small fatty chain to one specific spot on sermorelin make it hitch a ride on a blood protein, staying active far longer without breaking the part of the molecule that does the work?
If this modification works, it could convert sermorelin from a daily injection into a once-daily or twice-weekly shot, the same leap that made drugs like semaglutide far easier to use. That would address one of the biggest practical hurdles for patients using sermorelin long-term.
Could sermorelin slow the growth of glioblastoma, an aggressive brain tumor, by acting on a receptor the tumor cells carry, completely separate from its usual role in triggering growth hormone release?
If direct anti-tumor activity in glioblastoma is confirmed, sermorelin, already an FDA-cleared drug with a known safety profile, could potentially be repurposed as a treatment for a cancer with very limited options. That would offer a faster path to patients than developing an entirely new molecule from scratch.
Does sermorelin improve short-term memory by activating its receptor in brain cells directly, rather than by triggering the growth hormone surge that follows minutes later?
If the memory effect comes from the brain itself and not from downstream hormones, it would open a new path for designing sermorelin-like compounds that target cognitive function without touching the growth and body-composition system at all. That could matter for conditions like age-related memory decline, where activating the full growth hormone axis carries risks.
▸full evidence table2 metrics
| metric | value | tool |
|---|---|---|
| ipTM | 0.8681477904319763 | boltz-2 |
| ranking score | 0.7959436774253845 | boltz-2 |
▸structural qualityopenfold3
| metric | value | note |
|---|---|---|
| gpde | 0.561 | global PDE — lower = better |
| disorder | NaN | fraction disordered |
▸3-letter notation
▸recipeboltz-2 1.0
| parameter | value |
|---|---|
| model | boltz-2 1.0 |
| weights | — |
| hardware | nvidia_nim_api |
| mlx version | — |
| python | — |
| random seed | — |
| msa strategy | none |
| diffusion samples | 1 |
| runtime | — |
| predicted by | mlx@peptide |
| predicted at | 2026-04-24 |
▸citationbibtex
@peptide{pep04431,
sequence = {YADAIFTNSYRKVLGQLSARKLLQDIMSRQ},
target = {ghrhr},
author = {peptidemodel},
year = {2026},
status = {bioassayed}
}