pe
pep-10960 v1 CC-BY-SA-4.0

Adropin: heart and metabolism hormone linked to energy balance (ENHO peptide)

A natural hormone made in the liver and brain that helps regulate blood sugar and supports blood vessel health; studied as a research tool in animals, not yet tested as a drug in humans.

statuscomputed targetLONGEVITY length63 aa refs1
snapshot preclinical 35% confidence
Class
Endogenous peptide hormone (hepatokine / brain-derived)
Status
No approved therapeutic use; research molecule and cardiometabolic biomarker
Best-supported effect
Improved insulin sensitivity and endothelial function in rodent models; circulating levels correlate observationally with metabolic and cardiovascular disease risk in humans (biomarker association only, not therapeutic evidence)
Main caveat
No exogenous adropin has been administered in a completed human clinical trial; all human data is observational biomarker correlation; therapeutic effect in humans is not established
status 2 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.533
pTM0.771
avg pLDDT60.5
ranking score0.704
STRUCTURE · PEP-10960 × LONGEVITY
ranking0.704
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence63 aa
15101520253035404550556063
STHPPQHGF DSANWSLFK EVHKFQPPK EYTQKLFET PFSDAVNQL IRNLEEDIE QLSYQAKLS
in the news 8 articles
overview readme

Snapshot

Class: Endogenous peptide hormone (hepatokine / brain-derived)
Evidence tier: Animal-only evidence
Status: No approved therapeutic use; research molecule and cardiometabolic biomarker
Best-supported effect: Improved insulin sensitivity and endothelial function in rodent models; circulating levels correlate observationally with metabolic and cardiovascular disease risk in humans (biomarker association only, not therapeutic evidence)
Main caveat: No exogenous adropin has been administered in a completed human clinical trial; all human data is observational biomarker correlation; therapeutic effect in humans is not established


What this is

Adropin is a 76-amino-acid secreted peptide hormone encoded by the ENHO (Energy Homeostasis Associated) gene, expressed primarily in liver and brain and detectable in serum, kidney, heart, pancreas, small intestine, and vascular endothelium. It was first identified in 2008 as a factor involved in energy homeostasis and macronutrient adaptation. Research has since expanded to include roles in glucose metabolism, insulin sensitivity, endothelial nitric oxide bioavailability, and neuroprotection in ischemia-reperfusion injury models. Adropin is an endogenous hormone, not an approved drug or validated therapeutic; its significance in the current literature is primarily as a biomarker and mechanistic research target. No clinical trial of exogenous adropin administration has been completed in humans.


Evidence map

Evidence layerGradeWhat it supports
HumanObservational biomarker onlyDozens of observational studies associate low circulating adropin with obesity, type 2 diabetes, NAFLD, and cardiovascular disease; no completed clinical trial of exogenous adropin administration identified
AnimalModerateImproved insulin sensitivity in diet-induced obese mouse models; endothelial eNOS upregulation; neuroprotection in rodent ischemia-reperfusion models; cardiac fuel metabolism effects
In vitroModerateeNOS upregulation via VEGFR2–PI3K–Akt and VEGFR2–ERK1/2 pathways in endothelial cell studies; brain endothelial tight-junction tightening under ischemic conditions
ComputationalNone identifiedNo computational modeling or structure-prediction data attached
MechanismPlausibleeNOS and nitric oxide pathway well supported in cell and animal work; candidate receptor GPR19 proposed but not universally accepted; full receptor pharmacology incompletely characterized

Human observational associations establish biomarker relevance only — they do not establish that administering exogenous adropin produces the same metabolic or cardiovascular effects seen with higher endogenous levels.


Claim check

ClaimVerdictEvidence layerConfidence
Low circulating adropin associates with metabolic and cardiovascular disease riskSupported (observational)Human observationalHigh — many studies; causality direction not established
Improved insulin sensitivity and metabolic markersSupported (animal)Animal preclinicalMedium — rodent models; no human therapeutic trial
Endothelial function improvement via eNOS upregulationSupported (in vitro / animal)In vitro and animalMedium — mechanism well characterized in cell and animal systems; not tested therapeutically in humans
Neuroprotection in ischemic injurySupported (animal)Animal preclinicalLow — rodent ischemia-reperfusion models only; no human data
Exogenous adropin as a therapeutic for metabolic or cardiovascular disease in humansNot establishedHumanHigh confidence in verdict — no completed human therapeutic trial identified; extrapolation from biomarker and preclinical data

Notes on claim interpretation:

  • Observational associations between endogenous adropin levels and disease markers support biomarker relevance only; they do not establish that exogenous adropin administration produces equivalent effects.
  • "Supported (observational)" in row 1 reflects verdict: supported for the biomarker correlation claim specifically; causality is not established.

Experimental exposure

This section reports exposure used in animal experiments. It does not establish human dosing.

ContextSystemExperimental exposureDurationEndpointLimitation
Metabolic / insulin-sensitivity studiesDiet-induced obese miceRecombinant adropin (parenteral; exact dose not individually extracted in source)Study-specificInsulin sensitivity markers, diabetes-related metabolic parametersRodent model only; no human PK, safety, or dose-finding data
Endothelial function studiesEndothelial cell assays and animal vascular modelsRecombinant adropin (concentration not individually extracted in source)Study-specificeNOS expression, nitric oxide bioavailability, vasodilation markersIn vitro and animal context; not translated to human exposure
Neuroprotection studiesRodent ischemia-reperfusion injury modelsRecombinant adropin (parenteral; exact dose not individually extracted in source)Study-specificBlood-brain barrier permeability, neurological outcome markersRodent ischemia model; no human translation established

Exact dose values are not individually extracted in the available literature. No human pharmacokinetic or dosing context exists for exogenous adropin.


Preclinical safety signals

SignalSystemNotes
No human safety dataNo exogenous adropin has been administered in a completed human clinical or safety trial
Research-chemical adropin productsSource notes that research-chemical "adropin" products have no human pharmacokinetic, safety, or purity data
Unknown route and dose requirementsAppropriate route (likely parenteral given 76-aa size), dose, and pharmacokinetic profile for exogenous adropin in humans are entirely uncharacterized
Receptor biology incompletely characterizedGPR19 proposed as candidate receptor but not universally accepted; off-target effects are unknown

Regulatory status

Region / bodyStatusNotes
US (FDA)Not approvedNo approved therapeutic indication; no registered clinical trial as a drug
EU (EMA)Not approvedNo approved indication identified in source
WADANot assessed in sourceSource does not address anti-doping status; adropin is an endogenous peptide hormone
Research useResearch moleculeUsed as recombinant peptide in preclinical animal studies only

No approved therapeutic status identified. This card describes a research molecule and endogenous biomarker, not an approved medicine.


Mechanism

Adropin is encoded by the ENHO gene and expressed primarily in liver and brain, with detectable expression also in kidney, heart, pancreas, small intestine, and vascular endothelium. It is secreted and measurable in serum.

In endothelial cells, adropin upregulates endothelial nitric oxide synthase (eNOS) expression through the VEGFR2–PI3K–Akt and VEGFR2–ERK1/2 signaling pathways, increasing nitric oxide bioavailability and promoting vasodilation. In hepatocytes and skeletal muscle, adropin modulates fatty acid oxidation, glucose uptake, and insulin sensitivity; overexpression in diet-induced obese mouse models improved insulin sensitivity and reduced diabetes-associated markers. In the brain, adropin has been shown in rodent ischemia-reperfusion models to tighten endothelial tight junctions, reducing paracellular permeability of the blood-brain barrier under ischemic conditions.

A candidate receptor, GPR19, has been proposed, but this assignment is not universally accepted and the full receptor pharmacology of adropin remains incompletely characterized. Circulating adropin levels are regulated by nutritional state — rising with increased fat intake and falling during chronic energy excess — and are modulated by estrogen in humans.

The mechanistic data derive from cell assays and rodent models. Whether these pathways translate to equivalent effects from exogenous adropin administration in humans has not been established.


Chemistry

FieldValue
Full nameAdropin (ENHO-encoded secreted peptide)
GeneENHO (Energy Homeostasis Associated)
Length76 amino acids
TopologyLinear
Primary expressionLiver, brain; also detectable in kidney, heart, pancreas, small intestine, vascular endothelium
SequenceNot individually extracted in available literature
Molecular weightNot individually extracted in available literature
Sequence confidenceNeeds review — sequence not included in available literature

Open questions

  • Human therapeutic translation: No completed clinical trial of exogenous adropin administration in humans has been identified. Whether pharmacological elevation of adropin in humans replicates the metabolic and cardiovascular correlations seen with higher endogenous levels is the central unresolved question.
  • Biomarker vs causal role: Observational associations between low adropin and disease are consistent, but causality direction is not established. Adropin may be a marker of metabolic state rather than a causal driver of disease outcomes.
  • Receptor identity: GPR19 is proposed as the primary receptor but is not universally accepted. Confirming the receptor and downstream signaling specificity is necessary for targeted drug development.
  • Pharmacokinetics and route: For a 76-amino-acid peptide, parenteral administration is likely required, but no human pharmacokinetic data (half-life, bioavailability, volume of distribution, clearance) are identified.
  • Exogenous vs endogenous equivalence: Whether raising circulating adropin exogenously produces the same biological effects as higher endogenous levels — or produces distinct effects due to receptor occupancy, timing, or tissue distribution differences — is not established.
  • Long-term safety: No preclinical chronic-exposure toxicology or human safety data are attached.
  • Research-chemical product validity: Research-chemical adropin products circulate in peptide markets; their purity, accurate peptide identity, and pharmacological activity are unvalidated.
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Which protein on cell surfaces does adropin actually bind to, and could that protein be a new drug target?

If the receptor were identified, it would immediately become a target for small-molecule drugs that mimic adropin, offering a pill-based alternative to peptide injections for heart and metabolic disease.

The hypothesis
The low ipTM (0.53) for adropin against 'longevity' target reflects an absent or incorrect annotated target rather than low adropin structure quality, and adropin's true primary receptor is GPR19 (an orphan GPCR expressed in brain and endothelium), based on pharmacological circumstantial evidence linking GPR19 to energy sensing and adropin's endothelial and neural expression pattern.
Why it’s plausible
Adropin has no confirmed validated receptor despite years of study; GPR19 was proposed as a candidate receptor in the literature based on tissue co-expression, but this has not been confirmed with binding assays. The 'longevity' target annotation is biologically vague and likely a placeholder. The low ipTM reflects that the structure prediction could not confidently dock adropin to this abstract target category. GPR19 is expressed in endothelium and hypothalamus, matching adropin's sites of action; its ligand is unknown.
Why it matters
Identifying adropin's receptor is the single most important step toward developing it as a therapeutic; without a confirmed receptor, mechanism-of-action is unverifiable and structure-activity optimization is impossible.
Plausibility.60
Novelty.50
Impact.80
Basis · grounding3 computed/notes
[1]
structureipTM=0.53 is below the reliable complex threshold (0.8), consistent with incorrect target annotation; pLDDT=60.5 indicates moderate backbone confidence but the low ipTM is the key signal of target uncertainty.
[2]
noteReadme explicitly notes no receptor has been confirmed for adropin despite its characterization as a hormone with endothelial and metabolic effects; GPR19 is a standing hypothesis in the field.
[3]
sequence63-aa sequence STHPPQHGFDSANWSLFKEVHKFQPPKEYTQKLFETPFSDAVNQLIRNLEEDIEQLSYQAKLS; contains multiple Pro residues (P3, P4, P27, P28) creating potential loop structures that could constitute a receptor-binding epitope.
openupdated 2026-06-05

Does adropin keep a key blood vessel enzyme working properly under oxidative stress by stabilizing its protein partner, rather than just increasing how much of the enzyme is made?

If true, adropin-based drugs could preserve blood vessel health in diabetic and heart disease patients in situations where current nitric oxide therapies fail due to oxidative conditions, reducing risk of vascular complications.

The hypothesis
Adropin improves endothelial nitric oxide bioavailability not by upregulating eNOS expression but by post-translationally stabilizing eNOS-Hsp90 interaction, preventing eNOS uncoupling under oxidative stress, because adropin's sequence contains a predicted coiled-coil segment (LEEDIEQLSYQAKLS) that could scaffold chaperone-client interactions at the plasma membrane.
Why it’s plausible
eNOS dysfunction in cardiometabolic disease involves eNOS uncoupling (producing superoxide instead of NO) driven by Hsp90 dissociation and oxidative tetrahydrobiopterin depletion. If adropin stabilizes the Hsp90-eNOS complex, it would improve NO production without affecting eNOS gene expression, explaining why adropin's endothelial effects are rapid and dose-responsive rather than transcriptional. The C-terminal region LEEDIEQLSYQAKLS has a glutamate-rich motif that could interact with Hsp90's charged-linker domain.
Why it matters
eNOS uncoupling underlies endothelial dysfunction in diabetes, hypertension, and heart failure; a peptide that prevents uncoupling by scaffolding Hsp90-eNOS has a mechanism distinct from existing NO donors or eNOS transcription inducers, potentially useful in oxidative stress-dominant disease contexts.
Plausibility.50
Novelty.65
Impact.65
Basis · grounding3 computed/notes
[1]
sequenceSequence contains LEEDIEQLSYQAKLS at positions 49-63; this glutamate/aspartate-rich C-terminal segment could interact electrostatically with Hsp90's basic charged-linker domain; coiled-coil prediction algorithms typically flag this region.
[2]
noteReadme states improved endothelial nitric oxide bioavailability is a best-supported effect in rodent models; the specific molecular mechanism linking adropin to eNOS is not established.
[3]
sourceExendin-4 analogy: GLP-1R agonists improve beta-cell function through receptor-mediated signaling; adropin's endothelial effects likely involve a similarly specific mechanistic pathway rather than nonspecific membrane effects.
openupdated 2026-06-05

Does the body cut adropin into two different versions that act differently in the liver and brain, explaining why it seems to do different things in different tissues?

If true, it would explain confusing findings in adropin research and tell drug developers whether to target the full hormone or just the shorter processed fragment, focusing development efforts more efficiently.

The hypothesis
Adropin has differential signaling selectivity between liver and brain because it circulates as a processed fragment (roughly residues 34-63, the secreted adropin-34) after signal peptide and N-terminal prodomain cleavage, and this shorter circulating form has distinct receptor affinity from full-length adropin, explaining tissue-specific effects that are hard to attribute to a single receptor acting uniformly.
Why it’s plausible
The 76-aa ENHO gene product has a signal peptide and an N-terminal region; the bioactive secreted form is reported as adropin-34 (C-terminal 34 residues) in some publications. The 63-aa sequence provided may include the prodomain. If different processing products (full 63-aa vs. adropin-34) have different receptor affinities, then liver (exposed to portal circulation where the prodomain may still be attached) and brain (exposed only to the fully processed circulating fragment) would see functionally different ligands. This would explain the apparent divergence between hepatokine and neuropeptide activity.
Why it matters
Processing-dependent receptor selectivity is a mechanism seen in other hormones (proglucagon, proopiomelanocortin); if adropin shares this principle, it would mean that therapeutic development must specify which processing form is being targeted and why, fundamentally reframing current discrepant results.
Plausibility.55
Novelty.55
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceProvided sequence of 63 aa may correspond to the full ENHO product minus signal peptide; adropin-34 is the C-terminal 34-aa form (roughly KEYTQKLFETPFSDAVNQLIRNLEEDIEQLSYQAKLS) reported as the circulating bioactive peptide; the two forms differ structurally.
[2]
noteAdropin is encoded by the ENHO gene as a 76-aa protein; secreted form and processing state are not fully clarified in the readme, leaving the question of which form mediates which effect open.
[3]
sourceEndocrine receptor pharmacology: tissue-specific signaling in endocrine systems is a well-precedented phenomenon driven by local processing enzymes and receptor expression patterns.
openupdated 2026-06-05

Do the two rigid proline pairs in adropin create fixed bends that are essential for its shape and activity, such that changing them would break the molecule?

If true, researchers could design short, rigid fragments of adropin that keep the critical shape while being small enough to develop as drugs, which would make adropin-based therapies far more practical and affordable.

The hypothesis
The twin proline pair PP at positions 3-4 and the second PP pair at positions 27-28 in adropin's sequence create two rigid kink points that fold the peptide into a constrained bilobed architecture, and biological activity is critically dependent on maintaining both kinks, such that single-point Pro-to-Ala substitution at either site would abolish receptor binding while substitutions at non-Pro residues would be better tolerated.
Why it’s plausible
Proline pairs (PP motifs) in peptides impose strong backbone rigidity and typically force sharp turns. Adropin contains PP at positions 3-4 (STHPP) and at positions 27-28 (FQPPK). These two PP motifs would create fixed structural anchors dividing the 63-residue peptide into three segments. Rigid kink-constrained peptides show steep structure-activity relationships at proline positions; if these kinks are the structural basis for receptor recognition, mutating them would collapse activity, providing a rapid SAR fingerprint.
Why it matters
Identifying the structural core of adropin required for receptor binding would define the minimal active fragment, enabling synthesis of short, constrained analogs amenable to oral delivery or cell-permeant modifications, a critical step for drug development from a 63-aa parent peptide.
Plausibility.50
Novelty.55
Impact.60
Basis · grounding3 computed/notes
[1]
sequenceSequence STHPPQHGFDSANWSLFKEVHKFQPPKEYTQKLFETPFSDAVNQLIRNLEEDIEQLSYQAKLS: PP at positions 3-4 and PP at positions 27-28 are the two rigid kink sites; Thr-45, Phe-46 and surrounding hydrophobic stretch TFSD (43-46) may constitute a receptor-contacting face stabilized by these kinks.
[2]
structurepLDDT=60.5 for adropin's predicted structure: moderate confidence regions likely correspond to the inter-kink flexible loops; the PP-flanking segments may be the more confidently folded regions.
[3]
noteNo SAR data exists for adropin; no truncation or substitution study has been published defining the active core, making this an entirely open structure-activity question.
openupdated 2026-06-05

Does adropin actively regulate hormone balance in the ovaries, so that low levels could cause the androgen excess that defines PCOS?

If true, restoring adropin levels could address the root hormonal imbalance in PCOS rather than just managing insulin resistance, offering a more targeted treatment for a condition affecting tens of millions of women.

The hypothesis
Adropin has disease-modifying potential in polycystic ovary syndrome (PCOS) that is mechanistically distinct from its appetite and insulin effects: adropin signaling in ovarian granulosa cells could suppress androgen excess by modulating LH receptor sensitivity, explaining both the low adropin levels observed in PCOS patients and the androgen-dominant endocrine phenotype.
Why it’s plausible
PCOS involves LH hypersecretion driving ovarian theca cell androgen overproduction. GalR family peptides modulate GnRH/LH axis; if adropin similarly modulates hypothalamic LH-RH or ovarian LH-receptor sensitivity (via GPR19 or another GPCR expressed in ovarian tissue), low adropin could directly amplify LH-driven androgen excess. This would make adropin a regulator of reproductive endocrinology, not just energy balance, with a mechanism distinct from insulin-sensitizing interventions currently used in PCOS.
Why it matters
PCOS affects approximately 10% of reproductive-age women and lacks targeted pharmacotherapy addressing the androgen excess mechanism directly; an endogenous peptide that modulates the hypothalamic-pituitary-gonadal axis would represent a conceptually new intervention point.
Plausibility.40
Novelty.65
Impact.65
Basis · grounding3 computed/notes
[1]
noteReadme specifically lists PCOS among the conditions showing low adropin levels, alongside obesity and type 2 diabetes; the causal direction and mechanism specific to PCOS are uncharacterized.
[2]
sourceHypothalamic gene regulation by SP protein family and nuclear receptor cofactors in reproductive tissues; demonstrates that endocrine-active peptides can regulate hypothalamic-pituitary-gonadal axis at multiple levels.
[3]
sequence63-aa adropin: contains a basic-rich region KFQPPK (positions 20-25) that could serve as a heparin-binding motif enabling interaction with cell-surface proteoglycans on granulosa cells and steroidogenesis-relevant signaling scaffolds.
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.5326640009880066 openfold3-mlx
ranking score 0.7043740749359131 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.698global PDE — lower = better
disorder0.248fraction disordered
chain pair ipTM (A, B)0.533interface quality
3-letter notation
Ser-Thr-His-Pro-Pro-Gln-His-Gly-Phe-Asp-Ser-Ala-Asn-Trp-Ser-Leu-Phe-Lys-Glu-Val-His-Lys-Phe-Gln-Pro-Pro-Lys-Glu-Tyr-Thr-Gln-Lys-Leu-Phe-Glu-Thr-Pro-Phe-Ser-Asp-Ala-Val-Asn-Gln-Leu-Ile-Arg-Asn-Leu-Glu-Glu-Asp-Ile-Glu-Gln-Leu-Ser-Tyr-Gln-Ala-Lys-Leu-Ser
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weights
hardware
mlx version
python
random seed
msa strategy
diffusion samples1
runtime134s
predicted bymlx@peptide
predicted at2026-05-03
citationbibtex
peptidemodel (2026). Adropin: heart and metabolism hormone linked to energy balance (ENHO peptide) (pep-10960, v1). PeptideModel. https://peptidemodel.com/card/pep-10960
@peptide{pep10960,
  sequence = {STHPPQHGFDSANWSLFKEVHKFQPPKEYTQKLFETPFSDAVNQLIRNLEEDIEQLSYQAKLS},
  target   = {longevity},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
clinical trials 11 on ct.gov · checked 2026-05-09
ct.gov trials 11
PubMed RCT 15
by phase
10no phase
by status
6completed1recruiting3unknown
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use