pe
pep-10912 v1 CC-BY-SA-4.0

Shortened IGF-1 growth factor that dodges the body's blockers (des(1-3)-IGF-1)

A trimmed version of the natural growth signal IGF-1 that slips past the proteins which normally hold it back, showing stronger cell-growth and nerve-protecting effects in animal studies; experimental, not an approved drug.

statuscomputed targetIGF-1R length70 aa refs1
snapshot preclinical 35% confidence
Class
Truncated IGF-1 variant / growth factor analogue
Status
Not approved for any therapeutic indication; research-chemical market only
Best-supported effect
Near-complete IGFBP resistance and approximately 10× IGF-1R potency vs native IGF-1 (preclinical biochemical characterization); neuroprotective and neurotrophic effects in rodent CNS and retinal models
Main caveat
No human clinical trials for any indication; the central localized muscle growth claim is mechanistically plausible but has no human or directly applicable animal hypertrophy evidence in source
status 2 / 5
prediction metrics openfold3-mlx 0.3.1
ipTM0.460
pTM0.727
avg pLDDT56.5
ranking score0.578
STRUCTURE · PEP-10912 × IGF-1R
ranking0.578
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
openfold3-mlx 0.3.1 · mmCIF ↓ download
sequence70 aa
1510152025303540455055606570
GPETLCGAELVDAL QFVCGDRGFYFNKP TGYGSSSRRAPQTG IVDECCFRSCDLRR LEMYCAPLKPAKSA
in the news 2 articles
overview readme

Snapshot

Class: Truncated IGF-1 variant / growth factor analogue
Evidence tier: Animal-only evidence
Status: Not approved for any therapeutic indication; research-chemical market only
Best-supported effect: Near-complete IGFBP resistance and approximately 10-fold greater IGF-1R potency vs native IGF-1 (preclinical biochemical characterization); neuroprotective and neurotrophic activity in rodent CNS and retinal models
Main caveat: No human clinical trials have been conducted for any indication; the central "localized muscle growth" claim has no human imaging or controlled evidence, and no directly applicable animal hypertrophy study is present in the available literature


What this is

IGF-1 DES — formally des(1-3)-IGF-1 — is a naturally occurring truncated form of insulin-like growth factor 1, first identified in bovine colostrum and later detected in the human central nervous system and other tissues. It lacks the first three N-terminal amino acids (Gly-Pro-Glu) of native IGF-1, which constitute the principal domain for binding to IGF-binding proteins (IGFBPs). This structural difference confers near-complete IGFBP resistance and an approximately 10-fold increase in potency at the IGF-1 receptor (IGF-1R) relative to native IGF-1. The very short plasma half-life — estimated at tens of minutes — is an intrinsic consequence of the truncation, not an engineered property; loss of IGFBP stabilization shortens circulating lifetime markedly.

The peptide was characterized through academic research programs from the 1980s onward, notably by groups including Gluckman (New Zealand) and Ballard/CSIRO (Adelaide), and entered the research-reagent market as a cell-culture and in vivo research tool. Unlike IGF-1 LR3 — an engineered long-acting analogue — DES was never developed as a therapeutic agent. Human therapeutic development has not been pursued. It is distinct from mecasermin (Increlex), the FDA-approved IGF-1 product.


Evidence map

Evidence layerGradeWhat it supports
HumanNoneNo human trial data is present
AnimalModerateNeuroprotection in rodent hypoxic-ischemic brain injury; retinal neuroprotection in diabetic rat models; trophic effects on fetal brain tissue grafts; comparative CNS cholinergic activity vs native IGF-1
In vitroModerateIGFBP-independent IGF-1R binding and activation; dual effects on insulin release from isolated rat islets; comparative receptor-binding characterization vs native IGF-1 and IGF-2
ComputationalNone identifiedNo computational or structural prediction data attached
MechanismStrongIGF-1R agonism via PI3K/Akt/mTOR and Ras/MAPK pathways is well-established; IGFBP-independence is biochemically characterized across multiple independent research groups

The animal evidence base is concentrated in neurological and retinal models from the 1980s–1990s. Skeletal muscle hypertrophy evidence — the primary rationale cited in the research-chemical and bodybuilding context — is not individually extracted from any published animal or human study. The community use rationale rests on the mechanistic IGFBP-independence and short half-life characterization rather than on controlled muscle-hypertrophy experiments.


Claim check

ClaimVerdictEvidence layerConfidence
Near-complete IGFBP resistance and approximately 10× greater IGF-1R potency vs native IGF-1Supported (preclinical)In vitro / animalHigh
Neuroprotective and neurotrophic effects in rodent CNS and retinal modelsSupported (animal)AnimalMedium
Site-specific localized muscle hypertrophy at injection site in humansNot establishedAnimal / in vitroHigh — no human imaging, controlled human study, or directly applicable animal hypertrophy experiment supports this claim
Short half-life eliminates systemic riskWeak (preclinical inference)Animal / in vitroMedium — shorter half-life reduces systemic exposure vs LR3; acute hypoglycemia and systemic IGF-1R activation are reduced, not absent

Evidence-layer qualifier note: This is a preclinical-tier card. "Supported (preclinical)" and "Supported (animal)" are the correct verdict forms for positive findings. The localized hypertrophy claim that drives community use is the most prominent unvalidated claim on this card — mechanistically plausible, not directly studied.


Experimental exposure

This section reports exposure conditions used in animal experiments and preclinical studies. It does not establish human dosing.

ContextSystemExperimental conditionDuration / timepointEndpointLimitation
Animal experimentAdult rats; hypoxic-ischemic brain injury modelDes(1-3)-IGF-1 vs native IGF-1 and IGF-2; exact dose not individually extracted in sourcePost-injuryNeuronal survival; role of IGF-binding proteinsRodent model; no human CNS translation established
Animal experimentDiabetic rat retina modelDes(1-3)-IGF-1 treatment; exact dose not individually extracted in sourcePredegenerative timepointsIGF-1R and phospho-Akt (Thr308) immunoreactivityRodent diabetic model; no human ophthalmological translation established
Animal experimentFetal brain tissue graftsTruncated IGF-1; exact dose not individually extracted in sourceAcute / post-graftTrophic activity in graft tissueBrain graft preparation; not a standard in vivo model
In vitro / animalIsolated adult rat islets of LangerhansIGF-1 and DES comparative; exact concentrations not individually extractedPerifusion timepointsInsulin release (dual effect)Isolated-islet preparation; does not characterize systemic pharmacokinetics
In vitro / binding assayRecombinant IGF-1 / IGFBP preparationDes(1-3)-IGF-1 vs IGF-1 and IGF-2; exact concentrations not individually extractedAcuteIGFBP inhibition of biological activityBiochemical assay; characterizes binding properties, not in vivo exposure

Exact doses and concentrations used in the above experiments are not individually extracted from the available literature. Rows are presented to characterize experimental systems and endpoints studied, not as exposure references for other contexts.


Preclinical safety signals

SignalSystemNotes
Acute hypoglycemia potentialRodent islet studies; IGF-1 pharmacology extrapolationDual effect on insulin release documented in isolated rat islets; glucose lowering is shorter-duration than with LR3 but not absent, particularly at higher doses or with vascular administration
Mitogenic / proliferative risk with supraphysiologic IGF-1R stimulationTheoretical; IGF-1 biology backgroundSupraphysiologic episodic IGF-1R activation in proliferating tissue is a recognized concern based on IGF-1 pharmacology; no chronic exposure or carcinogenicity study specific to DES is identified
Local injection-site tissue changes from repeated IM injectionCommunity observation; uncontrolledSource describes community reports of local scarring, fibrotic palpable changes, and occasional sterile abscess with repeated injection into the same site; no controlled histological or imaging study is attached
Long-term safety in any species or systemNot establishedNo chronic animal toxicology, carcinogenicity, reproductive, or developmental safety data are individually extracted from the available literature

Human safety data are absent from the available literature. All signals above are extrapolated from preclinical IGF-1 pharmacology or from uncontrolled community observations, not from systematic human safety surveillance.

Source also describes the following per available sources contraindications as precaution context: active or recent cancer (especially hormone-sensitive), diabetes or impaired glucose regulation, pregnancy and breastfeeding, pediatric use, active acromegaly or untreated pituitary tumor, and active injection-site infection. These are per available sources cautions based on mechanistic inference, not label exclusions from a controlled trial.


Regulatory status

Region / bodyStatusNotes
US (FDA)Not approvedPer available sources, no FDA approval for any indication; distinct from mecasermin (Increlex); distributed via research-chemical channels labeled "not for human use"; Per available sources, distribution for human consumption as unauthorized under the FD&C Act; not a scheduled controlled substance per source
EU / UK / CanadaNot authorizedPer available sources, no authorization as a medicine in these jurisdictions; status is per available sources and has not been independently verified in this card-writing pass
Australia (TGA)per available sources Schedule 4Per available sources, TGA treats DES as a Schedule 4 prescription-only substance; not independently verified
WADAper available sources prohibited at all timesPer available sources, prohibition under WADA category S2 (peptide hormones, growth factors, related substances and mimetics) as an IGF-1 analogue; applies in and out of competition per source; current list status not independently refreshed in this card-writing pass

All regulatory and anti-doping statuses above are source-bundle reported. Current status has not been independently verified against live regulatory or anti-doping lists in this authoring pass.


Mechanism

Des(1-3)-IGF-1 is an agonist at the IGF-1 receptor (IGF-1R), a receptor tyrosine kinase. The deletion of the N-terminal Gly-Pro-Glu tripeptide removes the primary IGFBP-binding domain, resulting in near-complete bioavailability at IGF-1R without sequestration by circulating binding proteins. Receptor activation initiates two well-characterized downstream cascades: the PI3K/Akt/mTOR pathway (associated with protein synthesis, glucose uptake, and cell survival) and the Ras/MAPK pathway (associated with proliferation and differentiation). Because circulating IGFBPs normally sequester native IGF-1, the IGFBP-independent DES variant reaches the receptor at proportionally higher free concentrations per molar dose — approximately 10-fold greater potency in characterized assay systems.

The intrinsically short plasma half-life (tens of minutes) reflects the loss of binding-protein stabilization, which normally prolongs native IGF-1 circulating half-life. Rapid clearance is the mechanistic basis for the community claim that effects are primarily local following intramuscular administration. However, the available literature notes that "local-only" is an approximation of the dominant effect, not a guarantee of zero systemic IGF-1R activation.

The N-terminal tripeptide Gly-Pro-Glu released by the truncation is itself described as neuroactive in available literature and has been characterized as a separate bioactive fragment. Its pharmacology is distinct from des(1-3)-IGF-1 acting as an IGF-1R agonist.


Chemistry

FieldValue
Common nameIGF-1 DES; Des(1-3)-IGF-1; Truncated IGF-1; DES
StructureN-terminally truncated form of human IGF-1; lacks first three residues (Gly-Pro-Glu)
Length67 amino acids (native IGF-1 is 70 aa; DES is the 4–70 fragment)
TopologyLinear
Key structural featureLoss of N-terminal IGFBP-binding domain confers IGFBP independence
Disulfide bondsThree disulfide bonds (inherited from native IGF-1 fold)
Full amino-acid sequenceNot individually extracted from available literature
Molecular weightNot individually extracted from available literature
Molecular formulaNot individually extracted from available literature
CAS numberNot individually extracted from available literature
Sequence confidenceNeeds review — sequence not extracted; structural description derived from source narrative

The available literature characterizes DES as the naturally occurring 4–70 fragment of native IGF-1, lacking Gly-Pro-Glu at positions 1–3. Synthesis for research and market use has been as a recombinant or synthetic 67-residue fragment. Published research also notes documented supply-chain integrity issues: DES, IGF-1 LR3, and native IGF-1 are reportedly mislabeled for each other in the research-chemical market; no pharmaceutical-grade identity assurance pathway exists for commercial research-chemical products.


Open questions

  • Human translation of localized hypertrophy: The central claim driving community use — site-specific muscle growth at the IM injection site — has no human imaging study, no controlled hypertrophy trial, and no human pharmacokinetic characterization of local versus systemic IGF-1R activation from a representative dose. This is the highest-priority evidence gap for the community use context.
  • Controlled animal hypertrophy evidence: No directly applicable animal skeletal muscle hypertrophy experiment is individually extracted. The mechanistic rationale is based on IGFBP-independence and short half-life, not on a measured differential hypertrophy endpoint.
  • Human dose-response for any endpoint: The community dose range described in available literature (20–75 mcg IM per site) is derived from rodent-model extrapolation. No human dose-ranging study for any endpoint — hypertrophy, glucose lowering, or adverse effects — has been conducted.
  • Chronic local tissue histopathology: Repeated IM injection of a mitogenic peptide into the same anatomical site raises plausible concerns around fibrosis, chronic inflammation, and fibroblast dysregulation. No systematic imaging or histological study is identified.
  • Cancer-risk quantification from episodic supraphysiologic IGF-1R activation: The epidemiological literature linking IGF-1 to cancer is based on chronic-exposure associations. The risk implications of repeated short pulses of supraphysiologic IGF-1R stimulation in muscle tissue are unquantified.
  • Supply-chain identity and purity: available literature identifies documented mislabeling of DES, LR3, and native IGF-1 in research-chemical supply chains as an active integrity concern. No pharmaceutical-grade identity assurance exists for commercially available research-chemical DES products.
Hypotheses5 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Does des(1-3)-IGF-1 outperform regular IGF-1 at protecting nerve cells specifically when brain inflammation is high?

If true, it could mean that patients with stroke, head injury, or ALS would benefit from this modified peptide where multiple IGF-1 trials have failed, because the standard molecule was being blocked before it could reach damaged neurons.

The hypothesis
Des(1-3)-IGF-1, by virtue of near-complete IGFBP resistance, would maintain full IGF-1R signaling in the CNS microenvironment during acute neuroinflammation, where inflammatory cytokines upregulate IGFBP-2 and IGFBP-3 and thereby sequester native IGF-1 from injured neurons, making des(1-3)-IGF-1 a more effective neuroprotective agent than native IGF-1 in inflammatory neurodegeneration specifically.
Why it’s plausible
The readme documents neuroprotective and neurotrophic activity in rodent CNS and retinal models, and notes IGFBP resistance as the defining pharmacological property. In neuroinflammatory states (stroke, traumatic brain injury, ALS), IGFBP-2 and IGFBP-3 are upregulated in the parenchyma and cerebrospinal fluid, creating a local IGF-1 sink that native IGF-1 cannot overcome. Des(1-3)-IGF-1 lacks the N-terminal tripeptide Gly-Pro-Glu that mediates IGFBP binding (10.1677/joe.0.1640077), so it would remain bioavailable in this sink. Literature confirms that Long-R3-IGF-1, which is also IGFBP-resistant, shows increased bioavailability at target tissues (10.1371/journal.pone.0150453), providing pharmacological analogy.
Why it matters
If neuroinflammatory IGFBP upregulation is the mechanistic bottleneck for IGF-1-based neuroprotection, des(1-3)-IGF-1 would outperform native IGF-1 specifically in the inflammatory phase rather than uniformly, reframing both trial design and timing of intervention.
Plausibility.70
Novelty.50
Impact.75
Basis · grounding2 papers · 1 computed/note
[1]
paper
Reviews IGFBP proteases and binding specificity, establishing N-terminal domain of IGF-1 as IGFBP contact site absent in des(1-3)-IGF-1
doi: 10.1677/joe.0.1640077
[2]
paper
IGFBP-resistant Long-R3-IGF-1 shows increased bioavailability at target tissues vs native IGF-1
doi: 10.1371/journal.pone.0150453
[3]
noteNeuroprotective and neurotrophic activity confirmed in rodent CNS and retinal models; IGFBP resistance is stated as the key differentiator from native IGF-1
openupdated 2026-06-05

Could anchoring des(1-3)-IGF-1 to the collagen scaffolding of joints or bone make it stay active long enough to promote repair?

If true, it would convert a promising but practically useless molecule (it disappears too quickly to dose systemically) into a tool for treating osteoarthritis or accelerating bone healing after fracture, benefiting millions of people who currently have no good pharmacological options.

The hypothesis
Conjugating des(1-3)-IGF-1 to a collagen-binding peptide domain would anchor it to the cartilage or bone extracellular matrix, extend local residence time from minutes to days, and convert a systemically impractical molecule into a viable intra-articular or bone-repair therapeutic.
Why it’s plausible
The readme identifies very short plasma half-life as an intrinsic consequence of the truncation, making systemic delivery impractical. Local matrix retention is established for growth factors such as BMP-2 when fused to collagen-binding domains (e.g., von Willebrand factor A3 domain). Des(1-3)-IGF-1 retains full IGF-1R binding capacity and IGFBP resistance. Cartilage and bone are collagen-rich, IGFBP-3-rich compartments where IGF-1R is expressed on chondrocytes and osteoblasts. A bifunctional conjugate would address the pharmacokinetic liability without altering receptor pharmacology. The approach echoes IGF-1 slow-release from biomaterial scaffolds described in 10.3389/fbioe.2025.1492811.
Why it matters
Osteoarthritis and fracture healing represent large unmet needs where locally sustained IGF-1R agonism is mechanistically rational but pharmacokinetically unachievable with native or truncated IGF-1 alone; a matrix-anchored des(1-3)-IGF-1 conjugate could be the enabling technology.
Plausibility.65
Novelty.55
Impact.70
Basis · grounding2 papers · 1 computed/note
[1]
paper
Reviews biomaterial scaffold strategies to retain IGF-1 at injury sites, demonstrating the pharmacokinetic problem and motivating local-retention engineering
doi: 10.3389/fbioe.2025.1492811
[2]
noteVery short plasma half-life is an intrinsic consequence of truncation and loss of IGFBP stabilization, explicitly identified as the major practical limitation
[3]
paper
IGFBP-resistant IGF-1 analogs show increased bioavailability at target tissues, suggesting that local delivery of IGFBP-resistant form would maximize on-target exposure
doi: 10.1371/journal.pone.0150453
openupdated 2026-06-05

Could this modified IGF-1 regenerate the gut lining damaged by cancer chemotherapy more effectively than the standard molecule?

If true, it could reduce the severe mouth and gut sores that force many cancer patients to interrupt or stop treatment, potentially allowing more people to complete their chemotherapy courses.

The hypothesis
Des(1-3)-IGF-1, through its high-potency IGFBP-unshielded IGF-1R activation, could promote intestinal epithelial regeneration after chemotherapy-induced mucositis more effectively than native IGF-1, because the gut mucosa is an IGFBP-3-rich environment where exogenous IGF-1 bioavailability is severely curtailed and where IGF-1R-mediated crypt cell proliferation is the rate-limiting step for mucosal recovery.
Why it’s plausible
A 1994 American Journal of Physiology study (10.3109/08977199409010990) demonstrates that IGF-1 is the only known growth factor to induce linear growth of the adult small bowel, establishing IGF-1R as a valid mucosal target. Chemotherapy-induced mucositis involves crypt destruction and IGFBP upregulation in inflamed mucosa. Des(1-3)-IGF-1's IGFBP resistance would maintain receptor engagement in this environment. The very short plasma half-life (tens of minutes per readme) is less problematic for local intraluminal or subcutaneous dosing targeting the gut than for systemic muscle or CNS applications.
Why it matters
Chemotherapy-induced mucositis has no approved pharmacologic repair agent; an IGFBP-resistant IGF-1R agonist with local mucosal tropism could fill this gap and reduce hospitalization time from severe mucositis in oncology patients.
Plausibility.60
Novelty.50
Impact.65
Basis · grounding1 paper · 2 computed/notes
[1]
paper
IGF-1 is the only growth factor shown to induce linear small bowel growth in adults, establishing mucosal IGF-1R as the relevant target
doi: 10.3109/08977199409010990
[2]
noteNear-complete IGFBP resistance and 10-fold IGF-1R potency are stated as principal pharmacological differentiators
[3]
sourceShort half-life of growth factors under physiological conditions limits systemic delivery, motivating local delivery strategies for gut applications
openupdated 2026-06-05

Is des(1-3)-IGF-1 intrinsically better at grabbing its receptor, separate from the fact that it avoids binding proteins?

If true, it would mean the peptide is valuable even in tissues where blocking proteins are absent, expanding its potential uses and guiding the design of next-generation IGF-1 drugs with both properties deliberately engineered.

The hypothesis
The des(1-3) truncation shifts the conformational equilibrium of the B-domain N-terminus from a disordered state toward a more exposed receptor-contact conformation, directly explaining the approximately 10-fold potency increase at IGF-1R rather than this increase being attributable solely to IGFBP release.
Why it’s plausible
The openfold3 complex yields ipTM=0.46 for des(1-3)-IGF-1 against IGF-1R, only modestly higher than for MGF (0.40) and still below confident-interface threshold (typically >0.6-0.7), suggesting the predicted complex geometry is uncertain. The structure prediction has pLDDT=56.5, indicating significant local disorder. The canonical explanation for 10-fold higher potency is IGFBP removal, but binding assays reported in 10.1038/s41467-018-03219-7 that titrate IGF-1 directly against isolated IGF-1R (no IGFBPs present) could in principle distinguish an intrinsic affinity component. If the Gly-Pro-Glu tripeptide partially occludes the receptor-binding B-domain in native IGF-1, removal would intrinsically increase on-rate at the receptor surface.
Why it matters
Distinguishing conformational potency from IGFBP-release potency would determine whether des(1-3) analogs are valuable in IGFBP-low tissue compartments such as CSF or synovial fluid, and would inform structure-based design of IGF-1R agonists.
Plausibility.45
Novelty.55
Impact.55
Basis · grounding1 paper · 2 computed/notes
[1]
structureipTM=0.46 for des(1-3)-IGF-1/IGF-1R complex, modest confidence, pLDDT=56.5 indicating disordered N-terminus in the model
[2]
paper
Titration of IGF-1 against isolated IGF-1R extracellular domain provides structural context for B-domain engagement
doi: 10.1038/s41467-018-03219-7
[3]
note10-fold potency increase is described but the mechanistic attribution between IGFBP release and intrinsic affinity gain is not resolved
openupdated 2026-06-05

Does removing the three-amino-acid tip of IGF-1 change which version of its receptor it prefers, and could that make it more useful in metabolic disease?

If true, it would open a route to treating muscle wasting in type 2 diabetes and obesity using a naturally occurring molecule that acts more precisely in diseased tissue rather than all tissues equally, reducing unwanted side effects.

The hypothesis
Des(1-3)-IGF-1 preferentially activates hybrid IGF-1R/InsulinR receptors over pure IGF-1R homodimers because removal of the N-terminal tripeptide alters binding kinetics at the hybrid receptor interface, producing a differential signal bias between pure metabolic and pure growth outputs that native IGF-1 does not achieve.
Why it’s plausible
Native IGF-1 binds both IGF-1R homodimers and hybrid IGF-1R/IR receptors, with the hybrid being prevalent in insulin-resistant muscle and adipose tissue. The B-domain contacts are partially shared between both receptor forms, but the A-domain contributes differentially. Removal of Gly-Pro-Glu alters the N-terminal flexibility of the B-domain, which could modulate the docking geometry at the hybrid interface differently from the homodimer. The 10-fold potency increase documented for des(1-3)-IGF-1 has not been dissected between receptor subtypes; if the enhancement is greater at hybrids than homodimers, des(1-3) would be enriched for signaling in insulin-resistant tissues specifically.
Why it matters
Selective hybrid receptor agonism could produce anabolic signaling in metabolically dysregulated tissues (type 2 diabetes, obesity-related myopathy) with a different risk-benefit ratio from pure IGF-1R agonism, opening a new niche for this naturally occurring truncation.
Plausibility.40
Novelty.60
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
Reviews IGF-1R signaling regulation including hybrid receptor biology and the distinct signaling outputs from IGF-1R homodimers versus hybrids
doi: 10.1007/s00018-013-1514-y
[2]
paper
Antibodies targeting IGF-1, IGF-2 and extracellular IGF-1R are in clinical trials, confirming IGF-1R axis as druggable and motivating subtype selectivity
doi: 10.1111/bph.12449
[3]
sequenceGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA: lacks N-terminal GPE, altering B-domain flexibility at the receptor contact region
details expand to inspect
full evidence table2 metrics
metricvaluetool
ipTM 0.459502249956131 openfold3-mlx
ranking score 0.5779069066047668 openfold3-mlx
structural qualityopenfold3
0
metricvaluenote
gpde0.746global PDE — lower = better
disorder0.130fraction disordered
chain pair ipTM (A, B)0.460interface quality
3-letter notation
Gly-Pro-Glu-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala
recipeopenfold3-mlx 0.3.1
parametervalue
modelopenfold3-mlx 0.3.1
weights
hardware
mlx version
python
random seed
msa strategy
diffusion samples1
runtime137s
predicted bymlx@peptide
predicted at2026-05-03
citationbibtex
peptidemodel (2026). Shortened IGF-1 growth factor that dodges the body's blockers (des(1-3)-IGF-1) (pep-10912, v1). PeptideModel. https://peptidemodel.com/card/pep-10912
@peptide{pep10912,
  sequence = {GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA},
  target   = {igf-1r},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 4 by signal overlap
clinical trials 37 on ct.gov · checked 2026-05-09
ct.gov trials 37
with results 9
by phase
2phase 21phase 31phase 47no phase
by status
3completed2recruiting1terminated4unknown
references 1 papers
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use