receptor tyrosine kinase · human

IGF-1R

insulin-like growth factor 1 receptor
insulin-like growth factor 1 receptor · UniProt P08069 · gene IGF1R
muscle cancer aging

IGF-1R mediates the anabolic effects of IGF-1 on muscle, bone, and metabolism. MGF (mechano growth factor), IGF-1 LR3, and IGF-1 DES are peptide analogs targeting this receptor. The growth hormone lane of the platform centers on GH → IGF-1 → IGF-1R signaling.

browse 7 cards → upload → try → + watch target

anchor card · canonical reference for this target

anchor

Shortened IGF-1 growth factor that dodges the body's blockers (des(1-3)-IGF-1)

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA · 70 aa · @peptidemodel

designed pep-10912 @peptidemodel refs: 1

all cards · 7 candidates against IGF-1R

# id title author status refs ipSAE_d0chn ♥
1 pep-10812 Trofinetide: Daybue, first approved drug for Rett syndrome pe@peptidemodel
1 — 0
2 pep-10786 IGF-1 growth-factor fragment (residues 24: 41) pe@peptidemodel
11 — 0
3 pep-10828 Muscle & tissue growth booster (IGF-1 LR3) pe@peptidemodel
5 — 1
4 pep-10735 IGF-II growth factor fragment (IGF-II 33-40) pe@peptidemodel
8 — 0
5 pep-10734 IGF-1 middle fragment (positions 30: 41), small piece of the growth factor IGF-1 pe@peptidemodel
7 — 0
6 pep-10913 MGF: muscle-repair signal released by exercise (Mechano Growth Factor) pe@peptidemodel
1 — 0
7 pep-10912 Shortened IGF-1 growth factor that dodges the body's blockers (des(1-3)-IGF-1) pe@peptidemodel
1 — 0
1–7 of 7

target literature · 25 curated papers

[3]
Bagley, C.; May, B.; Szabo, L.; McNamara, P. et al. 1989 Biochemical Journal A key functional role for the insulin-like growth factor 1 N-terminal pentapeptide
cited by
1
cards
[4]
Janssen, J.; Hofland, L.; Strasburger, C.; van den Dungen, E. et al. 2016 PLOS ONE Potency of Full- Length MGF to Induce Maximal Activation of the IGF-I R Is Similar to Recombinant Human IGF-I at High Equimolar Concentrations
cited by
1
cards
[5]
Kletzl, H.; Guenther, A.; Höflich, A.; Höflich, C. et al. 2017 Growth Hormone & IGF Research First-in-man study with a novel PEGylated recombinant human insulin-like growth factor-I
cited by
2
cards
[6]
Wang, M.; Zhang, J.; Li, H.; Li, Y. et al. 2025 Frontiers in Bioengineering and Biotechnology Insulin-like growth factor-1 (IGF-1) empowering tendon regenerative therapies
cited by
1
cards
[7]
LeRoith, D.; Holly, J.; Forbes, B. 2021 Molecular Metabolism Insulin-like growth factors: Ligands, binding proteins, and receptors
cited by
2
cards
[9]
Xu, Y. et al. 2018 Nature Communications How ligand binds to the type 1 insulin-like growth factor receptor
cited by
2
cards
recent news 2 articles

discussion · 0 threads

No discussion threads yet.