IGF-1R mediates the anabolic effects of IGF-1 on muscle, bone, and metabolism. MGF (mechano growth factor), IGF-1 LR3, and IGF-1 DES are peptide analogs targeting this receptor. The growth hormone lane of the platform centers on GH → IGF-1 → IGF-1R signaling.
IGF-1R is the receptor tyrosine kinase that drives cell growth, proliferation, survival, and metabolism in response to IGF-1 and IGF-2. It is overexpressed in a broad range of cancers - breast, lung, colorectal, prostate, and pediatric sarcomas - and mediates resistance to multiple targeted therapies through AKT/mTOR pathway crosstalk. Despite its validation as a cancer target, IGF-1R inhibition has proved difficult clinically due to compensatory insulin receptor signaling and metabolic liability. The receptor also governs somatic growth, longevity biology, and tissue repair, making it a scaffold for both oncology and regenerative peptide programs.
IGF-1R (chromosome 15q26.3, 1367 aa) is a disulfide-linked (αβ)₂ heterotetramer: two extracellular α-subunits carry the ligand-binding L1-CR-L2 domains (cysteine-rich region mediates IGF-1 contact at Phe90 and key L2 residues), and two transmembrane β-subunits carry the intracellular kinase domain (activation loop Tyr1158/Tyr1162/Tyr1163). IGF-1 binds with Kd ~1 nM; IGF-2 binds with ~3-fold lower affinity; insulin cross-reacts at ~100-fold lower affinity. Ligand binding induces trans-autophosphorylation of the β-subunit activation loop → full kinase activation → IRS-1/2 phosphorylation → PI3K/Akt/mTORC1 (proliferation, survival, protein synthesis) and Shc/Grb2/Sos → Ras/MAPK/ERK (growth, differentiation). IGF-1R also translocates to the nucleus and acts as a transcriptional co-activator for PCNA and other growth genes. IGF-1R heterodimerizes with the insulin receptor (IR) to form hybrid receptors (IGF-1R/IR-A, IGF-1R/IR-B) that retain high IGF-2 affinity - a major escape mechanism from pure IGF-1R inhibition. IGFBP-3 (the dominant serum carrier) reduces free IGF-1 and modulates receptor access independently of receptor occupancy.
No IGF-1R–targeted peptide or small molecule has received regulatory approval. Monoclonal antibodies (cixutumumab, figitumumab, ganitumab) all failed Phase 2/3 trials, largely due to biomarker selection failure and hyperinsulinemia from IGF-1R blockade. Linsitinib (IGF-1R/IR TKI) failed in adrenocortical carcinoma. For peptide research, the tractable recipes are: IGF-1 truncated analogs (IGF-1 miniaturized to the B and A domains with C-domain deletions) that retain receptor binding while reducing IGFBP sequestration; bicyclic IGF-1 mimetics constrained with lactam or disulfide bridges to preserve the helical binding epitope; biased IGF-1R agonists that activate MAPK/ERK over Akt to drive tissue repair without proliferative risk; and IGF-1R/IR selectivity scans using Phe90 and the CR-domain contact residues to separate metabolic from mitogenic signaling at the peptide level.
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA · 70 aa · @peptidemodel
| # | id | title | author | status | refs | ipSAE_d0chn | ♥ |
|---|---|---|---|---|---|---|---|
| 1 | pep-10812 | Trofinetide: Daybue, first approved drug for Rett syndrome | pe@peptidemodel | 1 | — | 0 | |
| 2 | pep-10786 | IGF-1 growth-factor fragment (residues 24: 41) | pe@peptidemodel | 11 | — | 0 | |
| 3 | pep-10828 | Muscle & tissue growth booster (IGF-1 LR3) | pe@peptidemodel | 5 | — | 1 | |
| 4 | pep-10735 | IGF-II growth factor fragment (IGF-II 33-40) | pe@peptidemodel | 8 | — | 0 | |
| 5 | pep-10734 | IGF-1 middle fragment (positions 30: 41), small piece of the growth factor IGF-1 | pe@peptidemodel | 7 | — | 0 | |
| 6 | pep-10913 | MGF: muscle-repair signal released by exercise (Mechano Growth Factor) | pe@peptidemodel | 1 | — | 0 | |
| 7 | pep-10912 | Shortened IGF-1 growth factor that dodges the body's blockers (des(1-3)-IGF-1) | pe@peptidemodel | 1 | — | 0 |
No discussion threads yet.