LCR62 defensin germ-killing peptide
A natural peptide that kills or slows harmful microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Can a tightly folded protein fragment kill stubborn bacteria hiding in the slimy layers that protect them from most treatments?
Many infections on medical implants and in chronic wounds survive antibiotics because bacteria form a protective layer, called a biofilm, that degrades most peptide-based drugs. If LCR62 holds up inside those layers at doses safe for human tissue, it could be developed as a coating or rinse for surgical implants and hard-to-heal wounds, helping patients who currently face repeated infections with few options.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.4384666979312897 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05636,
sequence = {NMGCMAVLGSCGVITDCSGSCKTKFGQDASGDCDRDGGQGTCMCGYPCPHDKLHM},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}