Beta-defensin 125 germ-killing peptide
A short protein fragment that kills or disables bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could a molecule the body already makes in the epididymis be used to treat unexplained male infertility, or flipped around as a non-hormonal contraceptive?
If this holds, men diagnosed with unexplained poor sperm motility could have a treatment option built from a molecule the body already produces, which might mean fewer side effects than synthetic drugs. The same mechanism, blocked rather than boosted, could also open a hormone-free path to male contraception.
Does the unusually long dangling end of this peptide do something different from the main germ-killing part, and could you cut or swap it to tune what the drug does?
If the tail and the core work independently, researchers could trim or replace the tail to boost bacteria-killing power without disrupting the part that talks to human cells, or vice versa. That kind of precision matters a lot when turning a natural peptide into a safe, targeted drug.
Could this peptide latch onto the bacterial toxin that triggers runaway inflammation in sepsis and stop it from doing damage?
Septic shock kills roughly one in five people it strikes, and past attempts to neutralize the bacterial toxin involved have largely failed in clinical trials. If this peptide can bind and defuse that toxin effectively and safely, it could become an add-on treatment for a condition where doctors still have very few targeted options.
Could this peptide withstand the enzymes that the worst gum-disease bacteria use to destroy natural immune defenses?
Severe gum disease is notoriously hard to clear because Porphyromonas gingivalis, the main culprit, secretes enzymes that chew up the body's own defensive proteins. If this peptide's triple disulfide structure resists those enzymes, it could work as a topical treatment where conventional antibiotics fall short, without the resistance problems that come with long-term antibiotic use.
Cancer cells display a different surface charge than normal cells. Could that difference make this peptide selectively toxic to tumors?
Most chemotherapy drugs damage healthy tissue alongside cancer cells, causing severe side effects. If this peptide's charge and shape really do make it home in on the altered surface of cancer cells, it could point toward a new class of membrane-targeting cancer drugs derived from molecules the human body already makes, potentially with a gentler toxicity profile.
Bacteria resist many drugs by pumping them out of their cells. Could fastening this peptide to a surface stop that trick from working?
Antibiotic-resistant biofilms are a growing problem in dental care and infected wounds, and efflux pumps are one of bacteria's most effective escape routes. If this peptide can be anchored to a surface or coating in a way that keeps its killing end exposed and facing the bacteria, it could be built into dental implants or wound dressings that stay active even against strains that shrug off conventional antibiotics.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.41554495692253113 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05456,
sequence = {NWKIQRCWEKDIGHCRKRCFQNERYKLLCKNKLTCCIPITAQLSTPKPPPRVIYIEDITV},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}