Nisin-Z natural germ-killing peptide
A natural peptide that kills or slows the growth of bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Can a natural peptide already approved in food be made to work against the deadliest drug-resistant hospital bugs?
Carbapenem-resistant bacteria like Klebsiella and Acinetobacter kill thousands of hospitalized patients each year because almost nothing stops them. If pairing Nisin-Z with a membrane-loosening helper compound lets it reach and kill these bacteria, it could add a well-tolerated, low-cost weapon to a nearly empty arsenal, particularly for ICU patients with infections that no current antibiotic can clear.
Is there a single treatment that could tackle a bacterial infection and prevent the body from overreacting in a way that becomes fatal?
In severe bacterial sepsis, the infection itself is sometimes cleared but the immune system keeps raging, causing organ failure and death. If Nisin-Z can reduce that specific immune overreaction while also killing the bacteria, it could improve survival in patients where wiping out the microbe alone is not enough, a gap today's antibiotics cannot fill on their own.
Does this peptide work so differently from conventional antibiotics that bacteria find it nearly impossible to develop resistance against it?
Most antibiotics lose effectiveness over time because bacteria mutate the proteins the drug attacks. Nisin-Z appears to grab a molecule, Lipid II, that bacteria need to build their cell walls and cannot easily alter without dying. If binding that single target is both necessary and sufficient for killing, it would help explain the historically low resistance rates and give drug designers a precise blueprint for engineering even more effective versions.
Is this peptide naturally locked in an inactive form that only turns into a bacteria-killer once it arrives at an infected site?
A treatment that is inactive in healthy tissue but switches on only where bacteria are present could reduce side effects and concentrate killing power exactly where it is needed. If the leading segment of Nisin-Z keeps it dormant until specific enzymes at an infection site clip it off, that built-in safety switch might be exploited to design smarter, more targeted anti-infective therapies.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.503963053226471 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05566,
sequence = {MSTKDFNLDLVSVSKKNSGASPRITSISLCTPGCKTGAVMGCNMKTATCNCSIHVSK},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}