pe
pep-05561 v1 CC-BY-SA-4.0

Beta-defensin 43 germ-killing peptide

A peptide that kills or slows the growth of bacteria and other microbes; used only as a lab research tool.

statuscomputed targetANTIMICROBIAL length57 aa refs3
antimicrobial
EARLY ENTRY This candidate is newly indexed — supporting evidence is still being added. Have a paper or data point? Contribute below.
status 2 / 5 · 2 contributors
prediction metrics boltz-2 2.2.1
ipTM0.000
pTM0.503
avg pLDDT64.7
ranking score0.618
STRUCTURE · PEP-05561 × ANTIMICROBIAL
ranking0.618
?
RECEPTOR UNKNOWN
peptide conformation only · no target structure
target interface 4.5Å peptide drag rotate · ctrl+scroll zoom · right-click pan
sequence57 aa
151015202530354045505557
NTVFSLFKARSLFQEGCPP GYYNCRMKCNVNEYAVRYC ADWTICCKEKKKFKEKKKW
in the news 13 articles
Hypotheses6 directions▾ collapse

Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.

openupdated 2026-06-05

Could this peptide work by grabbing and disabling the toxic molecules bacteria release, rather than punching holes in bacteria directly?

If this holds, the peptide might help calm the runaway inflammation that kills sepsis patients, not just clear the infection. That would make it potentially useful for treating dangerous bloodstream infections where the toxin response is as deadly as the bacteria itself.

The hypothesis
The C-terminal KEKKKFKEKKKW motif of pep-05561 binds and neutralizes lipopolysaccharide (LPS) with higher affinity than the core beta-defensin scaffold alone, making LPS sequestration a primary mechanism of Gram-negative bactericidal activity rather than direct membrane pore formation.
Why it’s plausible
Pep-05561 carries an unusually extended cationic tail (KEKKKFKEKKKW) relative to canonical human beta-defensins 1-4, which have much shorter C-terminal regions. Poly-lysine clusters flanking an aromatic tryptophan closely resemble the LPS-binding pharmacophores of polymyxin B and WLBU2-class peptides, where alternating cationic and hydrophobic residues chelate the lipid A phosphate headgroups. The literature notes that beta-defensin antimicrobial activity can persist even after structural disruption (10.1042/BJ20082242), consistent with a tail-driven electrostatic mechanism that is independent of the disulfide-stabilized beta-sheet core.
Why it matters
If LPS neutralization is the dominant mechanism, pep-05561 would have therapeutic value beyond direct killing, potentially suppressing endotoxin-driven sepsis inflammation. This would also predict poor activity against Gram-positive organisms that lack LPS, sharpening the spectrum annotation.
Plausibility.61
Novelty.55
Impact.68
Basis · grounding2 papers · 1 computed/note
[1]
sequenceC-terminal sequence KEKKKFKEKKKW contains two poly-lysine clusters flanking a phenylalanine and capped with tryptophan, an architecture associated with LPS-binding peptides
[2]
paper
Cationic AMPs interact electrostatically with negatively charged surfaces including LPS; higher charge density increases this interaction
doi: 10.1177/0022034516679973
[3]
paper
Beta-defensin activities can persist even when the peptide is linearized or fragmented, suggesting non-scaffold-dependent mechanisms
doi: 10.1042/bj20082242
openupdated 2026-06-05

If the part of this peptide that breaks down fastest were replaced, could it last long enough to actually work as a medicine?

Most natural antibiotic peptides get chewed up by the body before they reach an infection. If this one weak spot can be fixed through a simple swap, it could clear a major hurdle toward turning this natural molecule into a usable drug.

The hypothesis
Cleaving or replacing the KEKKKFKEKKKW C-terminal extension with a shorter amphipathic helix-forming sequence will improve proteolytic stability without reducing antimicrobial potency, because the unstructured poly-lysine tail is the primary protease-accessible site that limits pep-05561 half-life in serum and mucosal fluids.
Why it’s plausible
The axis-hit literature confirms that disulfide-stabilized defensin cores are markedly more protease-resistant than linear peptide segments (10.1186/s12866-018-1190-z). The KEKKKFKEKKKW tail in pep-05561, having no predicted disulfide or stable secondary structure (reflected in the low plddt for a monomer without MSA), constitutes a dangling unstructured loop that serine and metalloprotease active sites can engage readily. Human beta-defensin 4 analogs with truncated C-termini retain or gain potency in engineering studies (10.1002/psc.2770), providing a direct precedent. Replacing this tail with a shorter, helicity-promoting sequence (such as a four-residue RRWW motif) could preserve cationic density while reducing the exposed protease-susceptible backbone.
Why it matters
Proteolytic instability in serum is a central barrier to clinical translation of all beta-defensins (10.3390/microorganisms8050626); demonstrating that the C-terminal tail is the liability in pep-05561 would enable a single point of engineering to resolve the primary pharmacokinetic obstacle.
Plausibility.61
Novelty.48
Impact.73
Basis · grounding2 papers · 1 computed/note
[1]
paper
Linear peptide segments lacking disulfide-stabilized tertiary structure are disproportionately susceptible to protease degradation compared with the defensin core fold
doi: 10.1186/s12866-018-1190-z
[2]
paper
Engineering linear analogs of hBD4 (a close relative) that modify the C-terminal region can generate peptides with improved or retained antimicrobial activity
doi: 10.1002/psc.2770
[3]
structureavg_plddt 64.7 in monomer mode indicates regions of disorder, most likely localized to the cationic tail rather than the disulfide-constrained core
openupdated 2026-06-05

Could this peptide zero in on cancer cells because their surface looks different from normal cells, and spare the healthy tissue around them?

Cancer cells often expose a tell-tale lipid on their surface that healthy cells keep hidden. If this peptide can exploit that difference, it might kill tumors with fewer side effects than current treatments, offering a new direction for people who have run out of options.

The hypothesis
Pep-05561 is selectively cytotoxic to cancer cells with elevated phosphatidylserine exposure on the outer membrane leaflet, while sparing normal epithelial cells, due to the additive electrostatic effect of both the core defensin scaffold and the KEKKKFKEKKKW tail targeting anionic lipid surfaces.
Why it’s plausible
The literature in the evidence bundle explicitly states that cancer cells lose membrane asymmetry, exposing anionic lipids (notably phosphatidylserine) on the outer leaflet, making them susceptible to cationic AMPs (10.1177/0022034516679973). Pep-05561 carries an unusually high cationic charge: the core beta-defensin scaffold contributes several arginines and lysines, and the KEKKKFKEKKKW tail adds at least 7 additional basic residues. This double-cationic architecture would amplify selectivity for cells with highly anionic outer leaflets beyond what canonical hBD1-3 achieve, since those peptides have lower net charge. The C-terminal tryptophan further anchors insertion into the hydrophobic core of loosely packed cancer-cell membranes.
Why it matters
Demonstrating selective cancer cell killing by pep-05561 at concentrations non-toxic to normal cells would open a direct oncolytic peptide development track, a high-value repurposing avenue for a peptide currently classified only as antimicrobial.
Plausibility.59
Novelty.48
Impact.69
Basis · grounding2 papers · 1 computed/note
[1]
paper
Cancer cells expose anionic lipids on outer membrane monolayer, which cationic AMPs exploit for selective cytotoxicity
doi: 10.1177/0022034516679973
[2]
sequenceNet positive charge is very high: R at positions 10, 22, 27, 38 plus K at positions 8, 45, 47, 48, 49, 51, 53, 54, 55 and terminal W, giving estimated net charge +11 or higher at physiological pH
[3]
paper
Beta-defensins are versatile and can acquire new functions including non-antimicrobial activities through the same membrane-targeting scaffold
doi: 10.1042/bj20082242
openupdated 2026-06-05

Could the core and the tail of this peptide act as independent modules, so engineers could improve one without breaking the other?

If the two regions truly work independently, it would give researchers a clean design platform: swap in a different tail to change how hard it hits bacteria, adjust the core to tune immune signaling, all without starting from scratch. That modularity could shorten the path to better-engineered versions.

The hypothesis
The six-cysteine disulfide core of pep-05561 adopts the canonical beta-defensin fold (triple-stranded antiparallel beta-sheet) even in the presence of the extended C-terminal tail, and the tail is conformationally independent of the core, meaning antimicrobial potency and immunomodulatory activity can be modulated independently by modifying tail versus core residues.
Why it’s plausible
Natural beta-defensins with C-terminal extensions (such as bovine BNBD-12 or some avian defensins) retain the conserved beta-sheet core independently of their variable tails. The 6-cysteine pattern in pep-05561 (with spacings CGxxxxC and CxC clusters matching positions ~17-42 in the sequence) is sufficient to nucleate the three-stranded sheet. The moderate ptm score of 0.50 from boltz-2 with no MSA is consistent with the core having a defined fold while the C-terminal tail is disordered. Structural independence of core and tail would mean that the two functional modules (receptor engagement via the core scaffold, membrane disruption via the tail) operate in parallel rather than in competition, a property exploitable in chimeric defensin design (10.1007/s12602-025-10456-y).
Why it matters
Confirming structural modularity in pep-05561 would validate a general design principle for next-generation chimeric defensins: a conserved core for immune signaling fused to customizable cationic tails for tunable microbicidal potency, with each module improvable without disrupting the other.
Plausibility.51
Novelty.40
Impact.62
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceSix cysteines at positions consistent with canonical C1-C5, C2-C4, C3-C6 beta-defensin disulfide connectivity; C-terminal KEKKKFKEKKKW is separated from last cysteine by only two residues, allowing tail to project freely
[2]
structureptm 0.503 and avg_plddt 64.7 in monomer mode suggest a partially structured molecule where the core is more ordered than the tail, consistent with structural independence
[3]
paper
Chimeric beta-defensin H4 (fusion of hBD3 and hBD4) shows that defensin cores can be combined without losing individual functional properties, implying modular architecture
doi: 10.1007/s12602-025-10456-y
openupdated 2026-06-05

Could this peptide burrow into the sticky bacterial layers that cause gum disease, where ordinary treatments fail to reach?

Dental biofilms act like a fortress that keeps most antibiotics out. If this peptide's extra-long charged tail lets it push through that barrier, it could become a topical treatment for periodontal disease, avoiding the complications that come with swallowing antibiotics.

The hypothesis
Pep-05561 has activity against biofilm-forming oral pathogens such as Streptococcus mutans and Porphyromonas gingivalis, and its combination of a disulfide-locked beta-defensin core with a highly cationic C-terminal tail confers superior biofilm penetration compared with canonical hBD1-3, making it a candidate topical agent for periodontal disease.
Why it’s plausible
One of the reference DOIs in the evidence bundle (10.1177/0022034516679973) is from the Journal of Dental Research and addresses AMP mechanisms in the oral context including biofilm. Beta-defensins are naturally expressed in gingival epithelium and salivary glands. The unusually long cationic tail of pep-05561 would facilitate penetration through the negatively charged polysaccharide matrix of dental biofilms (which acts as an electrostatic barrier to smaller-charge AMPs). The terminal tryptophan is known to anchor peptides into the hydrophobic cores of membrane aggregates, which could anchor the peptide to biofilm-embedded bacteria. Immobilized AMP paradigms noted in the bundle (10.1177/0022034516679973) are particularly relevant for surface-adherent biofilm applications.
Why it matters
Oral delivery avoids the systemic bioavailability problem central to AMP development. Topical periodontal application is a validated route for macromolecular therapeutics, and identifying pep-05561 as a biofilm-active agent would position it for a low-regulatory-risk first clinical indication.
Plausibility.47
Novelty.48
Impact.60
Basis · grounding2 papers · 1 computed/note
[1]
paper
Journal of Dental Research paper in the reference set discusses AMP mechanisms including surface-active peptides resistant to efflux in biofilm context
doi: 10.1177/0022034516679973
[2]
sequenceKEKKKFKEKKKW provides high cationic density to overcome the anionic polysaccharide barrier of dental biofilms, and the terminal W supports membrane anchoring
[3]
paper
Selectivity toward pathogens over commensals is a property of host-defense peptides relevant to oral microbiome preservation during therapeutic use
doi: 10.1038/s41573-019-0058-8
openupdated 2026-06-05

If this peptide works by overwhelming and collapsing bacterial membranes rather than drilling specific holes, would bacteria find it harder to evolve resistance against it?

Bacteria can learn to block the specific pores that many antibiotics try to form. A peptide that instead floods and collapses the whole membrane surface might be much harder to escape through mutation, which could make it a more durable option in the long fight against antibiotic-resistant infections.

The hypothesis
Pep-05561 kills bacteria primarily through a carpet/detergent mechanism rather than a toroidal pore or barrel-stave mechanism, because the extended lysine-rich C-terminal tail disrupts cooperative transmembrane insertion required for pore assembly.
Why it’s plausible
The sequence carries two dense lysine clusters (KKKFK and KKKW) at the C-terminus, producing a highly cationic, poorly helical tail that is unlikely to adopt the amphipathic helix required for classical barrel-stave pore formation. In carpet models, peptides tile the membrane surface until the bilayer collapses; this is consistent with the boltz-2 prediction showing moderate disorder (avg_plddt 64.7), which may reflect genuine conformational flexibility of the C-terminal tail. The literature confirms that beta-defensins with modified or extended C-terminal regions shift toward surface-disruptive rather than transmembrane-spanning modes (10.1002/psc.2770 context on engineered hBD4 analogs).
Why it matters
Mechanism assignment determines whether bacteria can evolve resistance via membrane thickening (blocks barrel-stave pores) versus increasing lipid head-group positive charge (which would also partially block carpet models). A carpet mechanism implies a higher resistance barrier and supports broader spectrum activity.
Plausibility.45
Novelty.30
Impact.47
Basis · grounding1 paper · 2 computed/notes
[1]
sequenceResidues 46-57 (KEKKKFKEKKKW) are poly-cationic and aromatic-capped, inconsistent with amphipathic helix formation needed for barrel-stave pore
[2]
structureavg_plddt of 64.7 indicates partial structural disorder, likely concentrated in the flexible cationic tail, consistent with carpet-mode surface tiling
[3]
paper
No single pore mechanism adequately explains defensin in vivo effectiveness, leaving carpet or toroidal models as alternatives
doi: 10.1016/j.jip.2018.07.005
details expand to inspect
full evidence table1 metrics
metricvaluetool
ranking score 0.6182671189308167 boltz-2
3-letter notation
Asn-Thr-Val-Phe-Ser-Leu-Phe-Lys-Ala-Arg-Ser-Leu-Phe-Gln-Glu-Gly-Cys-Pro-Pro-Gly-Tyr-Tyr-Asn-Cys-Arg-Met-Lys-Cys-Asn-Val-Asn-Glu-Tyr-Ala-Val-Arg-Tyr-Cys-Ala-Asp-Trp-Thr-Ile-Cys-Cys-Lys-Glu-Lys-Lys-Lys-Phe-Lys-Glu-Lys-Lys-Lys-Trp
recipeboltz-2 2.2.1
parametervalue
modelboltz-2 2.2.1
weights
hardwarevast_v100_32gb
mlx version
python
random seed1
msa strategynone_monomer
runtime
predicted by
predicted at2026-05-23
citationbibtex
peptidemodel (2026). Beta-defensin 43 germ-killing peptide (pep-05561, v1). PeptideModel. https://peptidemodel.com/card/pep-05561
@peptide{pep05561,
  sequence = {NTVFSLFKARSLFQEGCPPGYYNCRMKCNVNEYAVRYCADWTICCKEKKKFKEKKKW},
  target   = {antimicrobial},
  author   = {peptidemodel},
  year     = {2026},
  status   = {computed}
}
related peptides 5 by signal overlap
references 3 papers
[2] supporting
[3] supporting
discussion no comments
sign in to comment
peptidemodel.com CC-BY-SA-4.0 research only · not for human use