Beta-defensin 43 germ-killing peptide
A peptide that kills or slows the growth of bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could this peptide work by grabbing and disabling the toxic molecules bacteria release, rather than punching holes in bacteria directly?
If this holds, the peptide might help calm the runaway inflammation that kills sepsis patients, not just clear the infection. That would make it potentially useful for treating dangerous bloodstream infections where the toxin response is as deadly as the bacteria itself.
If the part of this peptide that breaks down fastest were replaced, could it last long enough to actually work as a medicine?
Most natural antibiotic peptides get chewed up by the body before they reach an infection. If this one weak spot can be fixed through a simple swap, it could clear a major hurdle toward turning this natural molecule into a usable drug.
Could this peptide zero in on cancer cells because their surface looks different from normal cells, and spare the healthy tissue around them?
Cancer cells often expose a tell-tale lipid on their surface that healthy cells keep hidden. If this peptide can exploit that difference, it might kill tumors with fewer side effects than current treatments, offering a new direction for people who have run out of options.
Could the core and the tail of this peptide act as independent modules, so engineers could improve one without breaking the other?
If the two regions truly work independently, it would give researchers a clean design platform: swap in a different tail to change how hard it hits bacteria, adjust the core to tune immune signaling, all without starting from scratch. That modularity could shorten the path to better-engineered versions.
Could this peptide burrow into the sticky bacterial layers that cause gum disease, where ordinary treatments fail to reach?
Dental biofilms act like a fortress that keeps most antibiotics out. If this peptide's extra-long charged tail lets it push through that barrier, it could become a topical treatment for periodontal disease, avoiding the complications that come with swallowing antibiotics.
If this peptide works by overwhelming and collapsing bacterial membranes rather than drilling specific holes, would bacteria find it harder to evolve resistance against it?
Bacteria can learn to block the specific pores that many antibiotics try to form. A peptide that instead floods and collapses the whole membrane surface might be much harder to escape through mutation, which could make it a more durable option in the long fight against antibiotic-resistant infections.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.6182671189308167 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05561,
sequence = {NTVFSLFKARSLFQEGCPPGYYNCRMKCNVNEYAVRYCADWTICCKEKKKFKEKKKW},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}