Cathelicidin-6 antimicrobial peptide
A naturally occurring peptide that kills or slows the growth of bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could this peptide's real job be calming or directing the immune system rather than punching holes in bacterial membranes?
If the current label is wrong, researchers could stop pursuing dead-end antibacterial work and instead test whether this peptide could help treat inflammation, slow-healing wounds, or immune overreaction. Redirecting the science earlier saves years of effort and could open a more promising path to treatment.
Can this peptide intercept the bacterial toxin that hijacks the immune system and causes the runaway inflammation seen in sepsis?
If it turns out to work this way, this peptide could help reduce the catastrophic immune overreaction in sepsis patients without needing to kill bacteria directly. That might make it safer at lower doses and could offer doctors a new tool against one of the leading causes of death in intensive care units.
Is there a short, looped piece of this peptide that does all the biological work, and does that work switch on or off depending on the body's chemical environment?
If the active part is just that small loop, chemists could build tiny, cheap copies of it rather than synthesizing the whole peptide. That could make any future drug based on this molecule far more practical and stable to produce.
Could this peptide reduce the chronic gut inflammation that makes inflammatory bowel disease so difficult to manage?
Millions of people with IBD have few safe long-term options that do not broadly suppress the immune system. If this peptide can calm gut inflammation without wiping out protective immune responses or harming beneficial gut bacteria, it could offer a gentler maintenance therapy for people living with these conditions.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.44689851999282837 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05511,
sequence = {LRVVDSLNQRSSDENLYRLLKLNSEPQGDENPNIPQPASFTVKETVCPKTTQQPLEQCD},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}