Natural germ-killing peptide
A short protein fragment that kills or slows the growth of bacteria and other microbes; used only as a lab research tool.
A researcher, an agent, or an algorithm wrote down the sequence and picked a target to hit.
An AI model like OpenFold3 or AlphaFold built a 3D structure and scored how well it fits the binding site.
A second contributor repeated the computation on their own hardware and the scores matched.
A chemistry service or a researcher ordered the sequence, it was manufactured, and mass spectrometry confirmed the right molecule was produced.
A binding or activity measurement confirmed that it actually does what the computer predicted — or didn't.
Research directions for this peptide, selected from the current sources — hypotheses you can explore and model. None of it is proven yet; tap any one to see the full thinking.
Could the unusual chemistry of this peptide make it hit dangerous skin and wound infections while leaving other bacteria alone?
Many antibiotics kill broadly, wiping out beneficial bacteria alongside harmful ones. If this peptide's charge profile really does steer it toward Gram-positive bugs like MRSA and drug-resistant Enterococcus, it could become a narrower, more targeted treatment option for those infections, with less collateral damage to the patient's microbiome.
Could the negative end of this peptide act like a safety latch that only releases when the peptide is near a bacterial surface, not a human one?
Most bacteria-killing peptides are indiscriminate and can damage red blood cells, limiting their clinical use. If the three-glutamate block on this peptide really does hold back its activity until it hits a bacterial surface, it might cause less harm to human tissue, making it a safer candidate for treating infections directly in the body.
If only the middle section of this peptide does the real work, could chemists cut away the rest and still get a useful drug at a much lower price?
Long peptides are expensive and slow to manufacture, which often blocks otherwise promising compounds from becoming real medicines. If a shorter, stripped-down version of this peptide holds onto most of its bacteria-killing ability, it could become affordable enough to actually develop, opening a path from lab curiosity to clinical candidate.
▸full evidence table1 metrics
| metric | value | tool |
|---|---|---|
| ranking score | 0.3557605743408203 | boltz-2 |
▸3-letter notation
▸recipeboltz-2 2.2.1
| parameter | value |
|---|---|
| model | boltz-2 2.2.1 |
| weights | — |
| hardware | vast_v100_32gb |
| mlx version | — |
| python | — |
| random seed | 1 |
| msa strategy | none_monomer |
| runtime | — |
| predicted by | — |
| predicted at | 2026-05-23 |
▸citationbibtex
@peptide{pep05484,
sequence = {EEECWMKGKCRLVCKNDEDSVTRCSNRKRCCILSRYLTIVPMTIDRMLPWTTPQVTQGDS},
target = {antimicrobial},
author = {peptidemodel},
year = {2026},
status = {computed}
}